kickassmetaltop100heavymetalalbumsofalltime987986543a331243223232423

Every band tries to achieve, a top 100 album either for a year, decade, century, or off all-time. Crucified Barbara was the first band in heavy metal history to achieve winning in 2005 not only the DEBUT ALBUM OF THE YEAR honor, but outright won the 2005 HEAVY METAL ALBUM OF THE YEAR, we were not called KICK*ASS*METAL during this era, we were called ORTHODOX METAL WORSHIP, KICK*ASS*METAL happened in early 2012. But no matter what, some bands will have 1 classic album, or have a top 100 albums for a year, but no band in traditional hard rock/heavy metal band has 5 releases on your top 100 heavy metal hall of fame albums.

80’s metal is only 40 years old, at the turn this decade, and Crucified Barbara has 4 albums and a DVD, release all in our top 100 albums of all-time, and all there releases are KICK*ASS*METAL HEAVY METAL HALL OF FAME ALBUMS.

 

Since Crucified Barbara as 18 years … 1998-July 14,2016. With a perfect discography, and a career with total artistic integrity in tact for there whole career. Crucified Barbara’s metallic mayhem will survive the test of time. And as a true fan of the band. There 4 albums and 1 DVD so far, are

Supreme Immortal Heavy Metal Metallic Art of the Highest Order. Hall of Fames, and Heavy Metal altars are build around albums such as “In Distortion We Trust” “‘Til Death Do Us Party”, “The Midnight Chase”and “In The Red”. Lets not forget if a metaller sees 12,000, 12,500, 13,000 concerts over his life time from age 16 til age 70….or longer… Crucified Barbara one stage, had tons of charisma, talent, conviction, originality, and a WOW FACTOR and a Savage factor, that for me personally I have to rank Crucified Barbara as top live HEAVY METAL ACT OF ALL-TIME.  Some where in the top 1o / top 25 of all-time.

 

If you ever see a heavy metal history book with no chapter on CRUCIFIED BARBARA, you got ripped-off and robbed. GET YOUR MONEY BACK @ ALL COST…!!!!!!!!!

CRUCIFIED BARBARA (SWEDEN) * IN DISTORTION WE TRUST 

CRUCIFIED BARBARA (SWEDEN) * ‘TIL DEATH DO US PARTY

CRUCIFIED BARBARA (SWEDEN) * THE MIDNIGHT CHASE

CRUCIFIED BARBARA (SWEDEN) * IN THE RED  

crucifiedbarbarametalofimmortals1ofthegreatestlivebandsofalltime98967976859689685685a13212321

CRUCIFIED BARBARA Heavy Metal legends from Stockholm Sweden, a top 100 heavy metal band of all-time, is one of KICK*ASS*METAL’s favorite all-time HEAVY METAL BANDS OF ALL-TIME.

As a Metal fan myself since 1980, I started with what is called NOW 1980’s Metal. Back in the early 1980’s it simply was called

KICK*ASS*METAL

 

THE IMMORTALS OF METAL have a distinct achievement in 20th and 21st CENTURY HEAVY METAL.

Crucified Barbara was the 1st HEAVY METAL band in HEAVY METAL history to win, in 2005

THE 2005 DEBUT ALBUM OF THE YEAR IN HEAVY METAL

and this album was so BAD*ASS and KICK*ASS it won HEAVY METAL’S

2005 Heavy Metal albums of the year, and it was one of heavy metal’s most competitive years in true real metal since 1999

and when that album “IN DISTORTION WE TRUST” was unleashed on PLANET METAL, we knew they were the future of heavy metal, and the future of this publication. Since we are the only music publication that focuses strictly on authenticity.

 

So when we get to ranking the top 100 heavy metal artist of all-time,

Expect Crucified Barbara, to be in the upper 99.0% of the top 100 heavy metal bands of all-time. Out of the upper 99.0% heavy metal bands of all-time. Crucified Barbara is upper 1% of all the upper echelon upper 99% heavy metal bands of all-time.

Of the 109,859 bands every journalist is aware in heavy metal there are another 200,00 hard rock bands in hard rock and the avant-garde genre.

So out of those 310,000 bands the upper 99,9 is around

3,100 heavy metal artist and out of those 3,100 top heavy metal bands of all-time

Crucified Barbara is a

TOP 100 HEAVY METAL BAND OF ALL-TIME.

crucifedbarbaratop100heaymetalbandsofalltimeaworldsgreatestlheavymetal98786854a2312323

 

Besides have a perfect 4 albums and 1 album discography.

 

All four of the Crucified Barbara albums have the rating of

100 out of 100 Blood dripping skulls, which means they are timeless masterpieces.

 

When ranking the top 100 HEAVY METAL guitar teams and guitar players of all-time.

 

Mia Coldheart / Klara Force will be in the upper-tier / upper echelon of the top 100 Heavy Metal Guitar Teams of all-time,

 

I have seen Crucified Barbara live, just as KILLER as Manowar and just as loud and Proud as Motorhead.

 

Without a doubt Crucified Barbara is a top 10/ top 25/ top 50 LIVE HEAVY METAL acts of all-time. If you missed Crucified Barbara live, you missed out one something just as KILLER as Manowar/Motorhead/Exodus/Metallica/Iron Maiden/Slayer/One-Eyed Doll/ Hanzel Und Gretyl/ Cradle of Filth…and the likes.

What makes a top 100 heavy metal band of all-time comes down to authenticity and charisma. These are aspects to World-Class Musicianship that can never be taught. Either you have it or you don’t.

Crucified Barbara had it just as much, at the same WORLD-CLASS HEAVY METAL level as Motorhead and Manowar….Metallica, Exodus, Iron Maiden, Slayer, Testament, Motley Crue, WASP…etc

 

crucifiedbarbaraheavymetallegends98797696785745a4231424342

 

klaraforcemiacoldhearttop10heavymetalguitaristofall-time98798796546a243242334jpg

Photo above top 10/ top 25/ top 100 heavy metal guitarist and guitar teams of all-time.

I rank Crucified Barbara as a live band in the top 10 / top 25 heavy metal bands of all-time, in the same upper part of a top 100 list with Manowar, Motorhead. Metallica, Exodus, Slayer, Motley Crue, WASP….etc. Crucified Barbara live was PURE MOLTEN HEAVY METAL, second to none. Best of the best, of all-time.

miacoldhearttop100heavymetalguitaristofall-time989799654a13312metallegend99

MIA COLDHEART TOP 100 HEAVY METAL GUITARIST OF ALL-TIME !!!!!!!!!!

miacoldhearttop100heavymetalguitaristofalltime9869865432a424324234

 

 

I think this will go over everyone’s head, but Motorhead has been a favorite band of mine, since 1980, and THE ONLY 198o’s HEAVY METAL band to maintain its INTEGRITY over the course of its 40 year plus career.

Like Motorhead Crucified Barbara formed in 1998 and 18 years, for the whole bands career, as a heavy metal artist with 100% artistic integrity, for the whole duration, of there legendary metallic career.

Crucified Barbara achieved 18 years as one of the greatest heavy metal bands of all-time. Heavy Metal only has a handful of artist with this fact attached to a bands legacy.

lemmykilmistermiacoldheartheavymetallegends98968543a232423

Out of all the bands ranked in the Motorhead family of band, I rank Crucified Barbara over all them all.

I rank Crucified Barbara, over all the top 100 heavy metal and top 100 glam metal albums of all-time. Crucified Barbara has the historic distinction, of there 2005 debut album also winning the 2005 Heavy Metal album of the year. A historic first for the heavy metal genre.

CRUCIFIED BARBARA HAS BEEN A HARD ROCK/ HEAVY METAL GOLD STANDARD SINCE 2005. EQUAL TO MOTORHEAD IN THE GOLDEN AGE OF HEAVY METAL 1980-1986. 1982/1983ERA MOTLEY CRUE AND 1991’S METALLICA “METALLICA”

 

Below is a previous article about Brazil’s Indiscipline’s (Brazil) 2 albums at the time being added to the heavy metal hall of fame list of the greatest heavy metal albums of all-time, since KICK*ASS*METAL considers Crucified Barbara and Indiscipline to be peers.

 

miacoldheartkickassmetalheavymetalhalloffamemember2005withindisciplinecd998557765

Atendendo a pedidos, prensamos uma edição limitadíssima do nosso CD
Live at Toca. São apenas 50 cópias numeradas a mão. Não haverá segunda prensagem! grin emoticon
Agora os fãs do produto físico também poderão curtir o lançamento, que conta com 3 músicas novas gravadas ao vivo no ‪#‎tocadobandido‬ através do projeto @converse @rubbertracks smile emoticon Quer garantir sua cópia? Então corre lá na nossa lojinha virtual: http://indiscipline.bigcartel.com smile emoticon // we’ve heard you and printed out a very limited exclusive 50 hand numbered copies edition of our album “Live at Toca”, which features 3 new songs recorded live at Rio’s celebrated Toca do Bandido studio through the ‪#‎Converse‬ ‪#‎RubberTracks‬ project. Hurry up, we won’t do a reprint! Go go go http://indiscipline.bigcartel.com/

In view of the applications, we press a limited edition of our CD
Live at play. Are only 50 copies numbered the hand. There will be no second pressing! grin emoticon
Now the fans of the physical product will also be able to enjoy the launch, with 3 new songs live recordings in ‪#‎tocadobandido‬ through the project @converse @rubbertracks smile emoticon wants to ensure your copy? Then run back in our virtual store: http://indiscipline.bigcartel.com smile emoticon// We’ve heard you and printed out the very limited exclusive 50 hand numbered copies edition of our album “live at play”, Which Features 3 NEW SONGS RECORDED LIVE AT RIO’s celebrated plays the villain studio through the ‪#‎talk‬ ‪#‎rubbertracks‬ project. Hurry up, we won ‘ T OF THE REPRINT! Go go go http://indiscipline.bigcartel.co
*********
******************
Above quote from Indiscipline’s offical facebook presence on the release of a new 3 song EP. THE BUY OR F@CKING DIE rule is in FULL-EFFECT FOR THIS 3 song EP…get it now no matter what !!!!!
***************************
Below KICK*ASS*METAL heavy metal Hall of Fame albums, essential albums from the RIFF LORD era of heavy metal May 1979- October 991, and essential albums form the Death Metal age from January 1990– (there is no end in sight from the DEATH METAL age ending, anytime soon).
***************************
*******************
*********

Abattoir * Vicious Attack

Accept * Restless And Wild

ACID * ACID

ACID * MANIAC

Agent Steel * Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis * Screams And Whispers

ANGEL DUST * Into The Dark Past

Angel Witch * Angel Witch

ANNIHILATOR * ALISION HELL

Annihilator * Never Neverland

ANTHRAX * FISTFUL OF METAL

Anvil * Metal On Metal

ANVIL * FORGED IN FIRE

Anvil * Live In Concert

Anvil * Worth The Weight

Anvil Chorus * Thought Crimes

Artillery * Fear of Tomorrow

ARTILLERY * TERROR SQUAD

Artillery * By Inheritance

ATHEIST * PIECE OF TIME

ATHEIST * UNQESTIONABLE PRESENCE

Atheist * Elements

Attacker * Battle At Helms Deep

Attacker * The Second Coming

BATHORY * BATHORY

BATHORY * THE RETURN

Black Sabbath * The Mob Rules

BLIND ILLUSION * THE SANE ASYLUM

Bloodlust * Guilty As Sin

Cage * Astronomy

Cathedral * Supernatural Birth Machine

CELTIC FROST * MORBID TALES

CELTIC FROST * EMPEROR’S RETURN

CELTIC FROST * TO MEGATHERION

Cirith Ungol * Frost and Fire

Cirith Ungol * King Of the Dead

COVEN *WITCHCRAFT REAPS MINDS AND DESTROYS SOULS

DIRECT INFLUENCE ON MERCYFUL FATE

COVEN * JINX

COVEN13 * WORSHIP NEW GODS

COVEN13 * RAGNAROK

COVEN13 * DESTINY OF THE GODS

CRUCIFIED BARBARA (SWEDEN) * IN DISTORTION WE TRUST 

CRUCIFIED BARBARA (SWEDEN) * ‘TIL DEATH DO US PARTY

CRUCIFIED BARBARA (SWEDEN) * THE MIDNIGHT CHASE

CRUCIFIED BARBARA (SWEDEN) * IN THE RED  

mariafernandacalskickassmetalheavymetalhalloffamemember2014a98958795797857

Photo above * Maria Fernanda Cals (Indiscipline) FAME * When it comes to the BEST OF THE BEST OF WORLD-CLASS HEAVY METAL Maria knows what RULES Planet Metal !!!!!!!!!!!!

Culprit * Guilty As Charged

Dark Age * Dark Age (Gnarly Records & RoadrunneR Records)

Dark Angel * Darkness Descends

Dark Angel * Leave Scars

DEATH DEALER * KEEPER OF THE FLAME

DEATH DEALER * JOURNEY INTO FEAR

Death * Scream Bloody Gore

Death * Leprosy

Death * Spiritual Healing

DEATH * HUMAN

DEATH * INDIVIDUAL THOUGHT PATTERNS

Death * Symbolic

Death Angel * The Ultra-Violence

Death Angel * Frolic Through The Park

DEATH ANGEL * ACT III

Death Strike * Death Strike

DEEP SWITCH * NINE INCHES OF GOD

Destruction * Infernal Overkill

DESTRUCTOR * MAXIMUM DESTRUCTION

Diamond Head * Lightning The Nations

EXCITER * HEAVY METAL MANIAC

Exciter * Violence & Force

Exciter * Exciter—Double Play Classic 1989 Megaforce/Caroline CD

EXHORDER * SLAUGHTER IN THE VATICAN

EXODUS * BONDED BY BLOOD

EXODUS * THE ULTIMATE REVENGE—COMBAT TOUR LIVE –VHS/DVI

EXODUS * PLEASURES OF THE FLESH

EXODUS * A LESSON IN VIOLENCE  COMBAT RECORDS 1991 CD

UNRELEASED STUDIO & LIVE TRACKS FEATURING ORIGINAL VOCALIST PAUL BALOFF * ULTIMATE REVENGE SOUNDBOARD SOUNDTRACK + MARCH 1986 + 3 SONG DEMO

EXODUS * ANOTHER LESSON IN VIOLENCE * LIVE 1997 CD

EXODUS * BONDED BY BALOFF * VOLVE CD

UNRELEASED STUDIO & LIVE TRACKS FEATURING ORIGINAL VOCALIST PAUL BALOFF * ULTIMATE REVENGE SOUNDBOARD SOUNDTRACK + MARCH 1986 + 3 SONG DEMO —-REMASTERED WITH BONUS TRACKS

EXUMER * POSSESSED BY FIRE

EXUMER * RISING FROM THE SEA

FORBIDDEN * FORBIDDEN EVIL

FORBIDDEN * TWISTED INTO FORM

The GATHERING * MANDYLION

The GATHERING * NIGHTTIME BIRDS

The Great Kat * Worship Me Or Die

Griffin * Flight of The Griffin

H-bomb * Attaque

Hawaii * One Nation Under Ground

HANZEL UND GRETYL *Über Alles –2003

HANZEL UND GRETYL * Scheissmessiah! –2004

HANZEL UND GRETYL * Oktötenfest

HANZEL UND GRETYL *  2012: Zwanzig Zwölf * 2008

HANZEL UND GRETYL * BORN TO  BE HEILED 2012 on METROPOLIS METAL

HANZEL UND GRETYL * Hanzel und Gretyl Für Immer (remixes by KyzrWölf) – 2013

HANZEL UND GRETYL * Black Forest Metal * 2014

HEATHEN * BREAKING THE SILENCE

HEATHEN * VICTIMS OF DECEPTION

Hellhammer * Apocalyptic Raids

HIRAX * RAGING VIOLENCE

For the CD age it was pressed as a anthology called NOT DEAD YET

HOLOCAUST * THE NIGHTCOMERS

Imagika * Imagika

Imagika * Worship

Imagika * And So It Burns

indsiciplineheavymetalhalloffame2014a999895787684534

Indiscipline (Brazil) * In My Guts

Indiscipline (Brazil) * Live At Toca

indisciplineinmygutsheavymetalhalloffamealbums2014a9859879879598795987

indisciplineliveattocakickassmetalheavymetalhalloffamealbum2015a989579875995897

INSANITY * DEATH AFTER DEATH

IRON MAIDEN * IRON MAIDEN

IRON MAIDEN * KILLERS

IRON MAIDEN * THE NUMBER OF THE BEAST

JAG PANZER * AMPLE DESTRUCTION

JAGUAR * POWER GAMES

JUDAS PRIEST * UNLEASHED IN THE EAST

Judas Priest * British Steel

Judas Priest * Painkiller

KING DIAMOND * FATAL PORTRAIT

KING DIAMOND * ABIGAIL

KING DIAMOND * THEM

Kreator * Endless Pain

Kreator * Pleasure To Kill

Liege Lord * Master Control

Macabre * Gloom

Malediction * Condamnés

MANOWAR * BATTLE HYMNS

MANOWAR * INTO GLORY RIDE

MANOWAR * HAIL TO ENGLAND

MERCYFUL FATE * MERCYFUL FATE

EXTENED PLAY 1982 1ST PRESSING WITH WHITE BORDER

MERCYFUL FATE * MERCYFUL FATE 

EXTENED PLAY 1982 * 2ND PRESSING

MERCYFUL FATE * MELISSA * OCTOBER 31ST, 1983 MEGAFORCE/ IMPORTANT RECORDS CD 

DIFFERNT SOUND ON THE TITLE TRACK

MECYFUL FATE * MELISSA * RoadrunneR CD

MERCYFUL FATE * DON’T BREAK THE OATH

MERCYFUL FATE * CURSE OF THE PHARAOHS

1986 FANCLUB PRESSING

MERCYFUL FATE * LIVE… FROM THE DEPTHS OF HELL

1986 FANCLUB PRESSING

MERCYFUL FATE * THE BEGINNING — 1987 COMPILIATON

Tracks 1-4 are the “Self-titled Rave-On Records” EP.*Tracks 5-7 from the “Friday Rock Show” radio show / “Rave-on sessions” *Track 8 is the “Black Funeral” EP’s B-side

MERCYFUL FATE * CURSE OF THE VAMPIRE —THE RARE AND UNRELEASED. Companion piece  to “Curse of The Pharaohs LP/Picture DISC and Cassette.”

MERCYFUL FATE *IN THE SHADOWS

MEGADEATH * RUST IN PEACE

METAL CHURCH * METAL CHURCH

METALLICA * KILL ‘EM ALL

METALLICA * RIDE THE LIGHTNING

METALLICA * MASTER OF PUPPETS

METALICA * CLIFF ‘EM ALL * 1987 VHS/DVD

MORBID ANGEL * ABOMINATIONS OF DESOLATION

MORBID ANGEL * ALTARS OF MADNESS

MORBID ANGEL * BLESSED ARE THE SICK

MORBID ANGEL * DOMINATION

MORBID ANGEL * ENTANGELD IN CHOAS

Motorhead * Ace of Spade

Motorhead * Iron Fist

MOTORHEAD * NO SLEEP ‘TIL HAMMERSMITH

Motorhead * Another Perfect Day

Motorhead * No Remorse

Motorhead * Orgasmatron

Nasty Savage * Nasty Savage

NASTY SAVAGE * INDULGENCE

NERVOSA * TIME OF DEATH

NERVOSA * VICTIM OF YOURSELF

Nightmare * Astral Deliverance

Nightmare * Live Deliverance

OBITUARY * SLOWLY WE ROT

OBITUARY * CAUSE OF DEATH

Obliveon * Nemesis

ONSLAUGHT * THE FORCE

OVERKILL * FEEL THE FIRE

Oz * Fire In The Brain

OZZY OSBOURNE * BLIZZARD OF OZZ

OZZY OSBORUNE * DIARY OF A MADMAN

OZZY OSBOURNE * TRIBUTE

PAGAN ALTAR * VOLUME ONE

Pentagram * Pentagram 1985 LP

Pentagram * Day of Reckoning

Pentagram * Relentless * 1985 LP retitled / reissued 1993

Pentagram “Pentagram” reissue is retitled “Relentless” and restores the original cassette mix and running order.

Pentagram * Be Forewarned

POSSESSED * SEVEN CHURCHES

Raven * Rock Until You Drop

Raven * Wiped Out

RAVEN * ALL FOR ONE

RAVEN * LIVE AT THE INFERNO

RAZOR * EXECTIONER’S SONG

RAZOR * EVIL INVADERS

REPULSION * HORRIFIED

Riot * Fire Down Under

Riot * Thundersteel

Riot * Privilege of Power

RUSH * A FAREWELL TO KINGS

RUSH * PERMANENT WAVES

RUSH * MOVING PICTURES

RUSH * SIGNALS

RUSH * GRACE UNDER PRESSURE

RUSH * POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * TEST FOR ECHO

RUSH * DIFFERET STAGES – LIVE

SACRIFICE * TORMENT IN FIRE

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLDIERS OF MISFORTUNE

SACRFICE * APOCALYPSE INSIDE

SATAN * COURT IN THE ACT

Scorpions * Taken By Force

SEPULTURA * BENEATH THE REMAINS

Sindrome * Sindrome * CD demos

The December 1987 Demo “In The Halls of Extermination” & The December 1991 Demo “Vault of Inner Conscience” on 1 CD * Sold by The bands management in the late 1990’s

Skullview * Kings of The Universe

SLAUGHTER * STRAPPADO

SLAUTERXSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER * SHOW NO MERCY

SLAYER * HAUNTING THE CHAPEL

SLAYER * LIVE UNDEAD

SLAYER * HELL AWAITS

SLAYER * REIGN IN BLOOD

Slayer * South Of Heaven

Slayer * Seasons In The Abyss

Syris * Unseen Forces

Tank * Filth Hounds of Hades

Tank * Power of The Hunter

TANK * THIS MEANS WAR

TERRORIZER * WORLD DOWNFALL

TESTAMENT * THE LEGACY

TESTAMENT * THE NEW ORDER

TESTAMENT * PRACTICE WHAT YOU PREACH

TROUBLE * LIVE 1983 DEMO CASSETTE ALBUM

TROUBLE * TROUBLE … AKA PSALMS 9

later retitled “PSALMS 9

TROUBLE * THE SKULL

TROUBLE * RUN TO THE LIGHT

TYGERS OF PAN TANG * WILDCAT

Tygers of Pan Tang * Spellbound

Tygers of Pan Tang * Crazy Nights

Venom * Welcome To Hell

Venom * Black Metal

Venom * At War With Satan

Vi0-lence * Eternal Nightmare

Voi Vod * War And Pain

U.F.O * The Wild, The Willing, And The Innocent

Unseen Terror * Human Error

WARGASM * WHY PLAY AROUND?

WARHEAD * SPEEDWAY

WARHEAD * THE DAY AFTER

WATCHTOWER * ENERGETIC DISASSEMBLY

WATCHTOWER * CONTROL AND RESISANCE

WITCH CROSS * FIT FOR FIGHT

Zoser Mez * Vizier of Wasteland

THIS LIST IN BOLD AND ITALIC IS THE TOP 100 ALBUMS OF ALL-TIME LIST of the DEATH METAL age

Abnormality * Contaminating The Hive Mind * 2012
Acheron * Rites of The Black Mass
Annihilator * Alice in Hell
Assassin * The Upcoming Terror
Bathory * Blood Fire Death
Bathory * Under the Sign of the Black Mark
Bestial Warlust * Blood and Valour
Bloodreaping * Ignis Penumbra
Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!
Centuions Ghost * A Sign of Things To Come
Coroner * RIP
Cradle of Filth * The Principle of Evil Made Flesh
Crest of Darkness (NORWAY) * The Ogress
Crest of Darkness (NORWAY) * Project Regeneration
Crown of Thorns (Sweden) * Eternal Death
Dark Angel * Darkness Descends
Death * Scream Bloody Gore
Death Angel * The Ultra- Violence
Destruction * Infernal Overkill
Deicide * Deicide
Disiplin (NORWAY) * Anti-Life
Dismember * Like a Every Flowing Stream
Entomed * Left Hand Path
Exodus * Bonded By Blood
Exumer * Possessed By Fire
Exumer * Rising By The Sea
Fleshcrawl * Bloodred Massacre
Gravehill * Rites of the Pentagram * 2009
Hellcannon * Infected With Violence
Impiety * Skullfucking Armeggedon
Impiety Koas Kommand 696
Internal Bleeding * Vocarcious Contempt
Iperyt * Totalitarian Love Pulse * 2007
Killaman * Killman
Kings Evil * Deletion of Humanoise
Kreator * Pleasue TO Kill
Krisiun * Black Force Domain
Leviathan * The Tenth Sublevel of Suicide
Massacra (FRANCE) * Final Holocaust
Massacre * From Beyond
Metallica * Kill em All
Metallica * Ride The Lightning
Morbid Angel * Altars of Madness
Mythos * Pain Amplifier
Nercodeath * Into the Macabre
Necromessiah * Antiklerikal Terroristik Deathsquad
Nervosa (Brazil) * Victim of Yourself * 2014
Nightside * The End of Christianity
Nile * Amongst The Catacombs of Nephren Ka
Nocturnal Breed (NORWAY) * Agressor
Nocturnal Breed (NORWAY) * Fields of Rot
Nocturnus * The Key
Occult * Of Fleash and Blood
Occult * Elegy For The Weak
Pessimist * Blood For The Gods
Pestilence * Malleus Maleficarum
Possessed * Seven Churches
Onslaught * The Force
Rabelliun (BRAZIL) * Burn The Promise Land
Ritual Carnage * The Highest Law
Sabbat * (NIPPON) * Envenom
Sabbat * (NIPPON) * Envoke
Sabbat * (NIPPON) * Disembody
Sabbat * (NIPPON) *Fetishism
Sabbat * (NIPPON) *Karisma
Sabbat * (NIPPON) *Satanasword
Sabbat * (NIPPON) * Karmagmassacre
Sabbat * (NIPPON) * …And the Sabbatical Queen
Sabbat * (NIPPON) * To Praise the Sabbatical Queen
Sabbat * (NIPPON) *Sabbatrinity
Sabbat * (UNITED*KINGDOM) * History of a time to Come
Sadus * Swallowed in Black
Sepultura * Beneath The Remains
Slayer * Show No Mercy
Slayer * Haunting The Chapel
Slayer * Hell Awaits
Slayer * Live Undead
Slayer * Reign In Blood
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007
Surrender of Divinity * Oriental Hell Rhythmic
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Urgehal * Goatcraft Torment *
Warfect * Exoneration Denied * 2013
Walhalla * Firereich
Vader * The Ultimate Incantation
Vader * Litnay
Voi Vod * War and Pain
Zyklon (NORWAY) * Aeon

A Hill To Die Upon * Infinit Titanic Immortal

Abaddon Incarnate * The Last Supper * 1999
Abigor (Austria) * Fractal Procession * 2007
Abigor (Austria) * Time Is The Sulpher In the Veins of the Saint * An Excursion on Satan’s Fragmenting Principle * 2010
Abnormality * Contaminating The Hive Mind * 2012
Aborym * Fire Walk With Us * 2001
Aborym * With No Human Intervention * 2003
Abruptum (SWEDEN) * Evil Genius * 1995

Acheron * Rites of The Black Mass * 1992
Acheron * Lex Talionis * 1994
Acheron * Hail Victory * 1995
Acheron * Anti – God, Anti -Christ * 1996
Acheron * Those Who Rise * 1998
Acheron * Rebirth * 2003
Acheron * The Final Conflict * 2009
Acheron * Kult De Hasses

Aeternus * …and So The Night Became * 1998
Aeternus * Shadow of Old * 2001
Aeternus * Ascension of Terror * 2001
Aeternus * A Darker Monument * 2003
Aeternus * HeXaeon

Altar * In The Name of The Father

Amputator * DeathCult Barbaric Hell * 2007

Angelcorpse * Of Lighting and Lucifer * 2007

Arkhon Infaustus (FRANCE) * Hell Injection * 2001
Arkhon Infasstus (FRANCE) * Filth Catalyst * 2003

Anateus (FRANCE) * Blood Libels * 2006

Asphyx * THE Rack * 1991
Asphyx * Deathhammer * 2012

Atrocity * Hallucinations * 1990
Atrocity * Todessehnnsucht * 1991

Autumnal * Rise of The Raging Death

Avulsed (SPAIN) * Goresplatter Suicide * 2005

Azaghal (FINDLAND) * Of Beast and Vultures * 2002

Behemoth (POLAND) * Zos Kia Cultus * 2002
Behemoth (POLAND) * Demigod * 2004
Belphegor (Austria) * Pestapokalypse VI * 2006
Bewitched (SWEDEN) * Spritual Warfare * 2006

Blasphemophagher (Italy) * The III Command of The Absolute Choas * 2011
Bloodduster *LYNDEN NA * 2007
Bloodline * Werewolf Training * 2003
Blood Freak * Sleaze Merchants * 2003
Blood Reaping * Ignis Penumbra * 2003
Blood Ritual * Black Grimore * 2005

Body Bag * Hate Crimes * 1995
Bone Gnawer * Feast of Fleash * 2009

Carpathian Forest * Fuck You All !!!!!! Caput Tuum In Ano Est * 2006

Celebratum (NORWAY) * Mirrored Revelation * 2001
Centurions Ghost (UNITED KINGDOM) * A Sign of Things To Come * 2005

Children of Technology * Futre Decay * 2014

Cirith Gorgor (NETHERLANDS) * Unveiling The Essence * 2001

Cradle of Filth * The Principle of Evil Made Flesh * 1994
Cradle of Filth * V Empire * 1996
Cradle of Filth * Dusk…and Her Embrace * 1996
Cradle of Filth * Cruelty and The Beast * 1998
Cradle of Filth * From The Cradle To Enslave * 1999
Cradle of Filth * Midian * 2000
Cradle of Filth * Bitte Suites To Succubi * 2001
Cradle of Filth * Damnation and a Day * 2003
Cradle of Filth * Nymphetamine * 2004
Cradle of Filth * Thornography * 2006
Cradle of Filth * Godspeed on The Devil’s Thunder * *2008
Cradle of Filth * Darkly, Darkly, Venus Aversa * 2010
Cradle of Filth * Midnight On The Ladybrinth * 2012
Cradle of Filth * The Manticore and Other Horrors * 2012

Craft (SWEDEN) * Fuck The Universe * 2005
Craft (SWEDEN) * Void * 2011
Cranium (SWEDEN) * Speed Metal Slaughter * 1998
Cranium (SWEDEN) * Speed Metal Sentence * 1999
Crest of Darkness * (NORWAY) * The Ogress * May 1999

Crest of Darkness * (NORWAY) * Project Regeneration * Nov 2001

Crytopsy (CANADA) * Blasphemy Made Flesh * 1994

Deathspell Omega (FRANCE) Fas- Ite, Maledicti, in Ignem Aeternum
Deceased * Fearless Undead Machines * 1997
Deceased * Supernatural Addiction * 2000
Deeds of Flesh * Inbreeding THE Anthropophagi * 1998
Dementor (SLOVAKIA) * Enslave The Week * 2001
Der Gerwelt (RUSSIA) * Human Breed * 2003
Desaster (Germany) * Satan’s Soldiers Syndicate * 2007
Desaster (GERMANY) * The Arts of Destruction * 2012

Diabloic * Excisions of Exorcism * 2010
Displin (NORWAY) *Anti-Life * 2005

Doomstone * Those Whom Satan Hath Joined * 1994
Doomstone * Satanvoid * 2000

E-Force (CANADA) * Evil Forces * 2003

Embalming Theatre * Sweet Chainsaw Melodies * 2003

Enslaved (NORWAY) * Vikingligr Veldi * 1994
Enslaved (NORWAY) * Mardraum * 2000
Enthroned (BELGIUM) * Carnage In Worlds Below * 2002
Eskhaton * Nihilgoety * 2011

Exalted * We Are The Grim Throng * 2007
Extreme Noise Terror * Retro-bution * 1995
Extreme Noise Terror * Damage 381

Fleshcrawl (GERMANY) * As Blood Rains From The Sky…We Walk The Path of Endless Fire * 2000

Frost (UNITED KINGDOM) * Talking To God * 2004

Furbowl (SWEDEN) * Those Shredded Dreams * 1992
Furbowl (SWEDEN) * The Autum Years * 1994

Gehenna (NORWAY) * Seeing Through The Veils of Darkness * 1995
Gehenna (NORWAY) * Malice * 1996

Ghoul * Maniaxe * 2003
Ghoul * Splatterthrash * 2006

Grand Belial’s Key * Judeobeast Assassination * 2001
Gravehill * Rites of The Pentagram * 2009
Grey (FRANCE) * The First Shade of….

Gorgoroth (NORWAY) * Ad Majorem Sathanas Gloriam * 2006

Guillotine * Under The Guillotine * 2007

Harm (NORWAY) * Demonic Allegiance * 2011

Hellcannon * Infected With Violence * 2010
Hellish Crossfire *Bloodrust Scythe * 2010

Howling * A Beast Conceived * 2013

Ill-Disposed * THERE IS LIGHT (BUT IT’S NOT FOR ME) * 2011

Impaled Nazarene (FINLAND) * Pro Pratia Finlandia * 2006
Imperial Sodomy (FRANCE) * Tormenting The Pacifist * 2001
Impiety (SINGAPORE) * Skullfucking Armageddon * 1999
Impiety (SINGAPORE) * KAOS KOMMAND 696

In Memorium * From Misery…Comes Darkness * 2003
Internal Bleeding * Voracious Contempt * 1995
Internal Bleeding * The Extinction of Benevolence * 1997
Internal Bleeding * Driven To Conquer * 1999
Internal Bleeding * Onward To Mecca
Inquisition * Obscure Verses for the Multiverse * 2013

Iperyt (POLAND) * Totalitarian Love Pulse

Judas Iscariot * Heaven In Flames * 1999

Katalklysm (CANADA) * Sorcery * 1995

Kerasphorus * Cloven Hooves at the Holocaust

Killaman (SWEDEN) * KILLAMAN * 2003

Konkorha (DENMARK) * Spit of Swallow * 1995

Krisiun (BRAZIL) * Black Force Domain * 1995
Krisiun (BRAZIL) * Apocalyptic Revelation * 1998
Legion of The Damned  * Feel the Blade

M

Marduk (Sweden) * NIGHTWING * 1998
Marduk * Wormwood

Necromessiah * Antiklerical Terrorristik Death Squad
Necronomicon (CANDA) * Rise of The Elder One * 2013
Necrophobic (SWEDEN) * The Nocturnal Silence * 1993
Necrophobic (SWEDEN) * Womb of Lilithu * 2013
Nervosa * Victim of Yourself

Omission (SPAIN) * Thrash Metal Is Violence * 2009

Power Trip * Manifest Decimation * 2013

RUINS (GERMANY) * Satanic Bitchpenetraton * 2008
RUINS (GERMANY) * Chambers of Perversion * 2010
Satanikca (ITALY) * Satanikattack * 2011
Sacrilegious Impalement (FINLAND) * Cultus NEX
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Slagmaur (NORWAY) * Vov Rov Shelter * 2009

The Grotesequery * Tales of The Coffin Box
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Tormentress (Singapore) * Thrashing Disorder * 2009
Trismesisto (ITALY) * Earie Black Path * 2009
Toxic Holocaust * Hell On Earth * 2005
Toxic Holocaust * Chemistry of Consciousness * 2013

Urgehal * Goatcraft Torment

Watain (SWEDEN) * Rabid Death Curse * 2000
Watain (SWEDEN) * Casus Luciferi * 2003
Watain (Sweden) * The Wild Hunt * 2007
Warfect * Exoneration Denied * 2013

mariafernandacalskickassmetalheavymetalhalloffamemeber2014a98959895879595

Advertisements