kickassmetalcollectorscornerpullthetriggericonickickass987789758985664a23424214

 

Below is the previous collector corners article about one of the greatest albums of metallic history. Exciter’s “Heavy Metal Manic”….This collectors corner if for Sacrifice “Forward to Termination”. Again a TOP 100 HEAVY METAL OF ALL-TIME given poor treatement and revisionism by the Metal Archives bunch. This Top 100 album of all-time has been mis-reviewed by the metal archives “staff” it is a place where those with zero knowledge of heavy metal and zero understanding how objective journalism works. So it is a million times more entertaining, that what ever else is in the news or whatever. I read those just for the laughs, because it never occurred to the owners of that place to 1st be fans of heavy metal, and second of all, learn to know what the f@ck your talking about.

Todays Collectors Corner article is Sacrifice’s “Forward to Termination” because your going to need this album again in 2016. I buy this album every year, I have 30 copies of it @ the KICK*ASS*METAL OFFICES.

As far as the best of the best file Sacrifice “Forward to Termination between Slayer’s “Reign in Blood” and Darkness “The Gasoline Solutions.

 

The Correct score for this ablum is 100 out of 100 BLOOD DRIPPING SKULLS, and the 3 dudes over at metal-archives, gave it a 92, 94, 88, 94. Pure fiction and pure fantasy. I believe to review over at Metal archives you must by a 100 bingo ping pongs balls with number 0—-to—-100, and just grab a number out of the barrel and

You got a zero / 0, and your album to review is Metallica “Master of Puppets”… 0 out of 100 one dude actually did that over there @ the infamous metal archives…!!!!

So the dudes over at metal-archives got all four review wrong with a score of 0% of any of the reviews being historically correct, but hey, at least 2 dudes got lucky and picked numbers over 93….maybe for the top 100 heavy metal albums of all-time, the metal archives reviewer dudes just pitches the 100 out of 100 ball, and rolls it down the street !!!!!!!!!!!!

 

EXCITER

METAL GODS

(Ottawa, Ontario/Canada)

HEAVY METAL MANIAC

TOP 100 HEAVY METAL ALBUMS OF ALL-TIME

 

The collectors corner feature, deals with what is a top 100 heavy metal album of all-time and the double edge sword scam of over/under rating albums over at Metal-Archives, and the subject matter of revisionism in heavy metal history.

 

The 2 scams over @ Metal archives since its inception and the eBay madness of the same era. I have been a heavy metal fan since 1978, so I know most of the top 100 list of the best albums are totally incorrect, and shocked most metallers are not up on  metal.

The first scam over at metal archives is finding a mint but rare micropressed album from the golden age of heavy metal, October 1981 to October 1986. And since for obvious reasons, it was found in a delete bin, and never reviewed in a ACTUAL HEAVY METAL publication. All one has to do is write a 100 out of 100 album review, and say it is a “lost treasure” and put it up on eBay for price of $1,500 and in the description quote the metal-archives article THAT THIS POWER SELLER wrote himself, not all eBayers sellers and power sellers are this dishonest.

But since it appears the owners of metal archives were never metallers in the first place, any review and any score is game, pick a records and pick a imaginary number from 1 to 100, fling the reviews to the wall, and see what happens.

 

For Exciter “Heavy Metal Maniac”

 

There were 10 useless reviews @ the metal archives and not one person correctly knew this is a top 100 heavy metal album of all-time.

 

So while the uneducated guesses, and wild picking of random numbers, are entertaining. I just always have known the actual GOLD STANDARD FOR HEAVY METAL, as a true metal fan since day 1 underground year zero.

For good laughs lets see what number’s ten metallers pulled out of thin air. No one metal fan over there got this right, but since it those who are not journalist and no actual standing in the metal community are allowed to say anything without any impunity, because metal archives pays it writers, 0 dollars and 00 sense. You get what you pay for applies here.

Ten wild f@ck ups over at the Metal archives. The biggest fraud here is the low score of a 70, and the closest score was a 96, which is a wild f@ck up like the strange and bizarre score of a 70.

83

82

85

88

87

80

89

96

83

70

 

EXCITER * “HEAVY METAL MANIAC”

IS A TOP 100 HEAVY METAL ALBUMS OF ALL-TIME

AND HAS ONLY ONE CORRECT SUBJECTIVE/OBJECTIVE SCORE

100 OUT OF 100 BLOOD DRIPPING SKULLS

 

Collecting heavy metal is not rocket science, IN ORDER TO COLLECT 1980’S HEAVY METAL CORRECTLY, BY THE ACTUAL GOLDEN AGE OF HEAVY METAL FANZINES, and build from there, and I mentioned there is a two fold scam that occurs over @ metal archives where albums of no relevance on actual heavy metal history get a A+ score, since the eBay scalper pulled a bait and switch type of fraud.

 

The second scam that goes on over there is albums of the golden age of heavy metal and the golden age of extreme metal and the golden age of the death metal age, will be scored low, because the dudes who wrote the scores in the 80 percentile, have 30 copies of this album of vinyl, cassette, and every world-wide pressing on CD. They are trying for you to cross it off of your want-list so they can buy it low, and horde multiple copies of this class and legendary album.

As a collector of heavy metal since 1978, Exciter “Heavy Metal Maniac” is a CD in first pressings I add to my collection on a year basis. My top 100 and top 700 albums are in each of my three houses I own, and a top 100 and top 700 album are in a military footlocker, and a 4th location.

The readers of metal archives are allowed  to be stupid as all they want to be, but you can not afford to be THAT STUPID, really no one can but since, that stupidity exists over there and all over the internet….!!!

Oh good luck finding a heavy metal magazine in 1982-1986 without any coverage of Exciter either in a news/review/interview or a write-up….!!!

Metal Archives is a strange and bizarre publication, to say the least. But I do love the entrainment, of there lack of heavy metal history knowledge.

I read various writers, just to see how bad/incorrect they write, just to make sure, none of them EVER get a job here….!!!!!!!!!

exciterheavymetalmaniactop100heavyemtalalbumsofalltime98967856743a2131231253453

 

 

exciterheaymetalmanictop100heavymetalalbjmsofalltime989676773432a123123

 

exciterheavymetalmaniactop100heavymetalalbumsofalltime9789789678543a3123132

 

Abnormality * Contaminating The Hive Mind * 2012
Acheron * Rites of The Black Mass
Annihilator * Alice in Hell
Assassin * The Upcoming Terror
Bathory * Blood Fire Death
Bathory * Under the Sign of the Black Mark
Bestial Warlust * Blood and Valour
Bloodreaping * Ignis Penumbra
Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!
Centuions Ghost * A Sign of Things To Come
Coroner * RIP

Cradle of Filth * The Principle of Evil Made Flesh * 1994
Cradle of Filth * V Empire * 1996
Cradle of Filth * Dusk…and Her Embrace * 1996
Cradle of Filth * Cruelty and The Beast * 1998
Cradle of Filth * From The Cradle To Enslave * 1999
Cradle of Filth * Midian * 2000
Cradle of Filth * Bitte Suites To Succubi * 2001
Cradle of Filth * Damnation and a Day * 2003
Cradle of Filth * Nymphetamine * 2004
Cradle of Filth * Thornography * 2006
Cradle of Filth * Godspeed on The Devil’s Thunder * *2008
Cradle of Filth * Darkly, Darkly, Venus Aversa * 2010
Cradle of Filth * Midnight On The Ladybrinth * 2012
Cradle of Filth * The Manticore and Other Horrors * 2012

Crest of Darkness (NORWAY) * The Ogress
Crest of Darkness (NORWAY) * Project Regeneration
Crown of Thorns (Sweden) * Eternal Death
Dark Angel * Darkness Descends

Darkness * The Gasoline Solution
Death * Scream Bloody Gore
Death Angel * The Ultra- Violence

Destruction * Infernal Overkill

Deströyer 666 *Unchain The Wolves

Deströyer 666 * Phoenix Rising

Deströyer 666 * Cold Steel…for a Iron Age

Deströyer 666 * Defiance

Deströyer 666 * Wildfire
Deicide * Deicide
Disiplin (NORWAY) * Anti-Life
Dismember * Like a Every Flowing Stream
Entomed * Left Hand Path
Exodus * Bonded By Blood
Exumer * Possessed By Fire
Exumer * Rising By The Sea
Fleshcrawl * Bloodred Massacre
Gravehill * Rites of the Pentagram * 2009
Hellcannon * Infected With Violence
Impiety * Skullfucking Armeggedon
Impiety Koas Kommand 696
Internal Bleeding * Vocarcious Contempt
Iperyt * Totalitarian Love Pulse * 2007
Killaman * Killman
Kings Evil * Deletion of Humanoise
Kreator * Pleasue TO Kill
Krisiun * Black Force Domain
Leviathan * The Tenth Sublevel of Suicide
Massacra (FRANCE) * Final Holocaust
Massacre * From Beyond
Metallica * Kill em All
Metallica * Ride The Lightning
Morbid Angel * Altars of Madness
Mythos * Pain Amplifier
Nercodeath * Into the Macabre
Necromessiah * Antiklerikal Terroristik Deathsquad

Nervsoa * 2012

nervosa2012top100heavymetalhalloffamealbumsofalltimemetalgodslegends9768967875463

nervosaheavymetallegendsmetalgods97685743242344786786786a312312313

 

Nervosa (Brazil) * Time of Death *

nervosatimeofdeathtop100heavymetal989897677

 

nervosa_timeofdeath897686785311_n
Nervosa (Brazil) * Victim of Yourself * 2014

nervosavictimofyourselftop100heavymetalalbumofalltime5a9879876661

 

nervosaheavymetallegendsmetalgodsheavymetalhallofamealbum978967856634412412a212321534

Nervosa (Brazil) * Agony * 2016

 

nervosaagonytop100heavymetalalblumofalltime2016albumoftheyear9987987987798554a113232112
Nightside * The End of Christianity
Nile * Amongst The Catacombs of Nephren Ka
Nocturnal Breed (NORWAY) * Agressor
Nocturnal Breed (NORWAY) * Fields of Rot
Nocturnus * The Key
Occult * Of Fleash and Blood
Occult * Elegy For The Weak
Pessimist * Blood For The Gods
Pestilence * Malleus Maleficarum
Possessed * Seven Churches
Onslaught * The Force
Rabelliun (BRAZIL) * Burn The Promise Land
Ritual Carnage * The Highest Law
Sabbat * (NIPPON) * Envenom
Sabbat * (NIPPON) * Envoke
Sabbat * (NIPPON) * Disembody
Sabbat * (NIPPON) *Fetishism
Sabbat * (NIPPON) *Karisma
Sabbat * (NIPPON) *Satanasword
Sabbat * (NIPPON) * Karmagmassacre
Sabbat * (NIPPON) * …And the Sabbatical Queen
Sabbat * (NIPPON) * To Praise the Sabbatical Queen
Sabbat * (NIPPON) *Sabbatrinity
Sabbat * (UNITED*KINGDOM) * History of a time to Come
Sadus * Swallowed in Black
Sepultura * Beneath The Remains
Slayer * Show No Mercy
Slayer * Haunting The Chapel
Slayer * Hell Awaits
Slayer * Live Undead
Slayer * Reign In Blood
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007
Surrender of Divinity * Oriental Hell Rhythmic
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Urgehal * Goatcraft Torment *
Warfect * Exoneration Denied * 2013
Walhalla * Firereich
Vader * The Ultimate Incantation
Vader * Litnay
Voi Vod * War and Pain
Zyklon (NORWAY) * Aeon

Darkness • The Gasoline Solution • High Roller Records
October 7th, 2016
Top 100 Heavy Metal Album of all-time.
File between Slayer ‘Reign In Blood’, Exodus “Bonded By Blood” and Nervosa “Victim of Yourself”
Top albums of 2016
Nervosa • Agony — Album of the Year — International
Crest of Darkness • Back from The Dead • Album of The Year — Norway
Abnormality • Mechanizations of Omniscience — Death Metal Album of The Year
Attacker • Sins of The World • Traditional Heavy Metal Hall of Fame Album
Darkness • The Gasoline Solution — gave Nervosa a run for there money, Nervosa won album of the Year, because of Prika Amaral’s GODLY GUITAR TONE.
The heavy metal genre is a tough genre, a top 100 album of all-time for Darkness “The Gasoline Solution”, but Nervosa still has the 2016 Heavy Metal of the year for actual heavy metal and actual heavy metal history.

WERE UP ON THRASH METAL

The Darkness “The Gasoline Solution is a awesome album fans of Slayer “Reign in Blood”, Kreator “Pleasure To Kill”, Destruction “Infernal Overkill”, and Nervosa “2012” “Time of Death”, “Victim of Yourself”, and “Agony” Take Notice”

 

prikamaralheavymetalhalloffamelegendgreatestthrashmetalguitarist21stcentury97898686743a21321212

 

prikaamaralkramerguitarheavymetallegend9879675463a33131312

 

prikamaralheavymetalhalloffamelegend987986787432a3123124534564

 

nervosa_kam_file_prika-amaral_547206_533197760062006_1359949251_n

 

prikaamaraltop100heavymetalguiatristofalltimemetallegend98796786574a231131231213

 

prikaamaralkickassmetasl2016heavymetalguitaristtop100heavymetalguitaristofalltime978965463

 

prikaamaralegaryholtworldsgreatestthrashers20the21stcentry989861223

kickassmetalheavymetalhalloffameprikaamaralnervosagods879678534241231245341

 

darknessthrashtildeathheavymetalhalloffamelegends989985674342a4324324234

 

darknessheavymetalgodstop100heavymetalalbumsofalltime97896789657452968967856a14343353324234

 

THE LIST ABOVE TOP OF PAGE  IS OUR EXTREME METAL…aka TRUE METAL TOP 100 HEAVY METAL ALBUMS OF ALL-TIME

 

THE LIST BELOW IS OUR TOP 100 HEAVY METAL ALBUMS IN THE TRADITIONAL METAL GERNE

 

KICK*ASS*METAL WITH MOLTEN METAL RIFFS

KICK*ASS METAL WITH MOLTEN METAL RIFFS.

Abattoir- Vicious Attack
Accept- Restless and Wild
Acid- Acid
ACID * MANIAC
ACID LIVE IN BELGIUM ’84
Agent Steel- Skeptics Apocalypse
Agent Steel * Mad Locust Rising
Anacrusis- Screams and Whispers.
ANGEL DUST- INTO THE DARK PAST
Angel Witch * Angel Witch
ANNIHILATOR * ALICE IN HELL
Annihilator * Never, Neverland
ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS
Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS
Anthrax * Spreading the Disease … features songs written by Neil Turbin…
Anvil- Metal on Metal
ANVIL- FORGED IN FIRE
Anvil- Live in concert
Anvil-Worth the weight
ANVIL CHORUS * THOUGHT CRIMES
Anvil Chorus * The Killing Sun
Artillery * Fear Of Tomorrow
ARTILLERY * TERROR SQUAD
ARTILLERY * By Inheritance
ATHEIST- PIECE OF TIME
ATHEIST- UNQUESTIONABLE PRESENCE
Attacker-Battle at Helms Deep
Attacker-Second Coming

Attacker * Giants of Canaan

 

BATHROY * BATHORY
Bathory * The Return…
Bitch * Damnation Alley
Bitch- Be My Slave
Black Death * Black Death * Auburn Records
Black Sabbath- Mob Rules
BLIND ILLUSION- THE SANE ASYLUM
Bloodlust – Guilty As Sin
BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS
BLITZKRIEG * A TIME OF CHANGES
CACOPHONY- SPEED METAL SYMPHONY
Cage- Astromy
Candlemass-Nightfall
Carnivore * Carnivore
Cathedral- Supernatural Birth Machine
CELTIC FROST- MORBID TALES
Celtic Frost- Emperors Return
Celtic Frost- To Mega therion
CELTIC FROST- INTO THE PANDEMONIUM
Chastain * Mystery of Illusion
Chastain * Ruler of the Wasteland
Chastain * The 7th of Never
Chastain * The Voice of Cult
Chastain- For those who Dare
CHASTAIN- IN A OUTRAGE
COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE
COVEN * Worship New Gods…Coven …aka Coven13
COVEN13 DESTINY OF THE GODS
CIRITH UNGOL * FROST AND FIRE
CIRITH UNGOL * KING OF THE DEAD
Crimson Glory- Crimson Glory

Crucified Barbara * In Distortion We Trust

Crucified Barbara * ‘Til Death Do Us Party

crucifiedbarbraoneofthegreatestheavymetalartistofalltim9999999e89778955645453

Crucified Barbara * The Midnight Chase

Crucified Barbara * In The Red
CRYPTIC SLAUGHTER * CONVICTED
Culprit- Guilty As Charged
CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld
Dark Angel * We Have Arrived
DARK ANGEL * DARKNESS DESCENDS
DARK ANGEL * LEAVE SCARS
DEF DEALER * KEEPER OF THE FLAME
DEF DEALER * JOURNEY INTO FEAR
DEATH- SCREAM BLOODY GORE
DEATH * LEPORSY
DEATH- SPIRITUAL HEALING
DEATH- HUMAN
DEATH-INDIVIDUAL THOUGH PATTERNS
DEATH * Symbolic
Death Angel- The Ultra-Violence
DEATH ANGEL- ACT III
Death Strike-Fuckin’ Death
Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe
Ded Engine * Hot Shot
Ded Engine * Hold A Grudge
Deep Switch- Nine inches of God
DESTRUCTION- INFERNAL OVERKILL
Diamond Head * Diamond Head…1980 …aka Lightning to the Nations
Diamond Head- Lightning to the Nations
Diamond Head- Behold the Beginning
Discharge * Hear Nothing, See Nothing, Say Nothing
Dream Death- Journey Into Mystery
DOCTOR BUTCHER- DOCTOR BUTCHER

edgeofparadisemaskkickassmetalheavymetalhalloffamealbum998768768456353453453534

edgeofparadisekickassmetalheavymetalhalloffame987686567434524554

edgeofpardise_immortalwaltz_may22nd2015_album_artwork987653432131334n

EDGE OF PARDISE  * MASK

EDGE OF PARADISE * PERFECT SHADE OF GREY

EDGE OF PARDISE * IMMORTAL WALTZ

edgeofparadisedekickassmetallegendsheavymetalhalloffamemetalgods98976967574535235236567867854-8787654pg

edgeofparadisekickassmetalheavymetalhalloffamelegendsmetalgods987967544123213675872234242

 

 

kickassmetalalbumoftheyear2015_98798765432

EXCITER- HEAVY METAL MANIAC

exciterheaymetalmanictop100heavymetalalbjmsofalltime989676773432a123123
Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS
EXCITER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

exciterheavymetalmaniactop100heavymetalalbumsofalltime9789789678543a3123132
Exhorder- Slaughter in the Vatican
EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE
EXODUS- BONDED BY BLOOD
EXODUS- PLEASURES OF THE FLESH
EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)
EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)
EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)
Exorcist * Nightmare Theatre
EXUMER * POSSESSED BY FIRE

FATES WARNING * NIGHT ON BROKEN
Fear of God * Within The Veil
FORBIDDEN- FORBIDDEN EVIL
FORBIDDEDN * TWISTED INTO FORM

THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS

Girlschool * Hit and Run
GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS
GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS
THE GREAT KAT- WORSHIP ME OR DIE!
THE GREAT KAT- BEETHOVEN ON SPEED
THE GREAT KAT- BEETHOVEN SHREDS
Griffin- Flight of the Griffin

Hawaii- One Nation Underground
HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK
HALLOWEEN- DON’T METAL WITH EVIL
Hell- Hell (1982)…Demos come with 2 disc version of 2011 CD
H-Bomb- Attaque
HEATHEN- BREAKING THE SILENCE
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now

Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS
Iron Maiden- The Number of the Beast

Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
Massacre- From Beyond
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE

THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH
MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE
MERCYFUL FATE- INTO THE SHADOWS
METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- NO LIFE TIL LEATHER
METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview
METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end
METALLICA* LIVE * METAL UP YOUR ASS..1983 DEMO CASSETTE
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Metallica- Creeping Death/ Jump in the Fire CD
Metallica- Master of Puppets
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron

Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE

nervosathefourhorsemenoftheapocalypse21stcentury987657846746374436347756767

nervosarulesplanetmetal_9978957969709258122606873_n

nervosaonradio_98976966590927_n

fernandaliraworldclassheavymetalvocalist978685a4542a1231231342424

NERVOSA (thrash Brazil) * 2012
NERVOSA (thrash Brazil  * TIME OF DEATH

NERVOSA (thrash Brazil) *VICTIM OF YOURSELF

NERVOSA (thrash Brazil) * Agony

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

nervosa2012top100heavymetalhalloffamealbumsofalltimemetalgodslegends9768967875463

nervosaheavymetallegendsmetalgods97685743242344786786786a312312313

nervosaheavymetallegendsmetalgodsheavymetalhallofamealbum978967856634412412a212321534

nervosathrashmetalgodsheavymetalhalloffamekickass978686574242143214124234343

 

Nightmare * Astral Deliverance

OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilevon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power

The Rods * Wild Dogs

RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE
RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swallowed in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO
SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
Saxon * Denim and Leather
Scorpions- Taken By Force
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD
SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS
SUICDIAL TENDENCIES * SUICIDAL TENDENCES
SYRIS * Unseen Forces

Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error

Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
Warlord-Deliver Us
Warlord * And The Cannons Of Desturuction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
Whiplash * Power & Pain
Whiplash * Ticket to Mayhem
Wildestarr * Arrival
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon
Zoser Mez- Vizer of Wasteland

 

 

nervosathrash2016heavymetalablumoftheyearshinigamipostercd99999999a6577432

 

collectorcornertop100heavymetalalltime987987987

So they way this article works, your on eBay, because you WILL NEVER EVER SEE a Exciter “HEAVY METAL MANIAC” used ever in first, 2nd, 3rd, 4th, or 5th pressing ever.

You see a BUY IT NOW FEAUTRE….

PULL THE TRIGGER

On that eBay buying feature…and enjoy a MOLTEN METALLIC MASTERPIECE

kickassmetalcollectorscornerpullthetriggericonickickass987789758985664a23424214

Advertisements