surgikillsanguinaryrevelationm318206a989574541345

 

In 2016 there were 5 albums that left an indelible mark on my psyche as well as the history books of heavy metal, the deepest scares in the history books for all things KICK*ASS, were Abnormailty “Mechanizations to Omniscience”, Nervosa “Agony”, Surgikill “Sanguinary Revelations”, Darkness “The Gasoline Solution”, and Asphyx “Incoming Death”….and tons of others, 2016 was one of the best years in heavy metal, as a true fan of the genre since 1978…. There are top 10’s elsewhere please flip thorough the chapters. But all top 100 list are not perfect, as the 1980’s metal movement is in its 37th year. 1980-2017. This top 100 is WHAT ALBUMS HEAVY METAL HALL OF FAMES AND WHAT ALBUMS ALTARS FOR HEAVY METAL ARE BUILT AROUND

Abnormality “Contaminating The Hive Mind

Abnormality “Mechanizations To Omniscience”

Acheron “Rites of the Black Mass”

Asphyx  “Asphyx”

Bathory “Bathory”

Bathory “The Return….”

Bathory “Blood Fire Death”

Bloodreaping “Ingins Penumbra”

Carpathian Forest “FUCK YOU ALL !!!”

Carnage  “Dark Recollections”

Celtic Frost  “Morbid Tales”

Celtic Frost “Emperor’s Return”

Celtic Frost  “To Mega Therion”

Centurions Ghost “A Sign of the Times”

Cradle of Filth “Principle of Evil Made Flesh”

Crest of Darkness “The Ogress”

Crest of Darkness “Project Regeneration”

Crown of Thorns “Eternal Death”

Entomed “Left Hand Path”

Exumer “Possessed By Fire”

Death “Scream Bloodly Gore”

Decide “Deicide”

Deicide “Legion”

Dispiln “Antilife”

Gravehill “Rites of the Pentegram”

Impiety “Skullfucking Armageddon”

Impetigo “Horror of Zombies”

Incantation  “Onward to Golgotha”

Iperyt “Totalitarian Love Pulse”

Killaman “Killaman”

Kings-Evil “Deletion of Humanoise”

Krisiun “Black Force Domain”

Leviathan “The Tenth Sublevel of Suicide”

Massacra  “Final Holocaust”

Massacre “From Beyond”

Massacre “Back From Beyond”

Master ” Master”

Morpheus Descends  “Ritual of Infinity”

Morbid Angel  “Abominations of Desolation”

Morbid Angel “Altars of Madness”

Morbid Angel “Blessed are the Sick”

Morbid Angel “Covenant”

Mythos “Pain Amplifier”

Naglfar “Vittra”

Nervosa “2012”

Nervosa “Time Of Death”

Nerovsa “Victim of Yourself”

Nervosa “Agony”

Necromessiah “Antiklerical Terrorisk Death Squad”

Necrophobic -“The Nocturnal Silence”

Nightside “End of Christianity”

Nile “Amongst The Catacombs of the Nephren-Ka”

Nocturnal Breed “Agressor”

Nocturnal Breed “Fields of Rot”

Nocturnus “The Key”

Nocturnus “Thresholds”

Obituary  “Cause of Death”

Occult “Rage to Revenge

Occult “Elegy for the Weak”

Pessiminst “Blood For the Gods”

Possesed “Seven Chuches”

Rabaelliun “Burn the Promise Land”

Rabaelliun “Annihilation”

Ritual Carnage “The Highest Law”

Slaughter “Strappado”

Slayer “Show No Mercy”

Sinners Burn “Insanity Warmachine”

Sodomizer “The Dead Shall Rise”

Surgikill “Sanguinary Revelations

Suffocation – Effigy of the Forgotten

Surrender of Divinity “Oriental Hell Rhythmic”

Therion -“Of Darkness”

Therion “Beyond Sanctorum”

Tsjuder “Antiliv”

Urgeheal  “Goatcraft Torment”

Warfect “Exoneration Denied”

Winters of Sin “Violence Reigns Supreme”

Vader  “The Ultimate Incantation”

Vader “Litany”

Zyklon “World of Worms”

Zyklon “Aeon”

surgikillsanguinaryrevelationm318206a989574541345

 

crestofdarknesskickassmetalheavymetalhallofamelegend9879789

darknessthegasolinesolutionkickassmetalheavymetalhallofamealbum987789789789789

nervosatop100heavymetalalbumofalltime99987978989784a20116

 

iperypttotalitarian87978978656543

impietykickassmetal8979898765665a12323213

krisiumblackfrocedomain897898978986

sepulturabeneahtheremainstop100heavymetalalbumofalltime99998878787a1989

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

nervosaheavymetalgodslegends98797896772341413431242323423

deicidelegionkickassmetal9999789879798

 

destuctionkickassmetalheavymetalhallofamealbum989786754353pg

therionofdarkness-kickassmetal98979765745

slayershownomercytop100albumofalltime9898777

metallica_killem_all_9786476455623462353523453

metallica_killemall_974867334232

 

Timeline from

Abnormality “Containing the Mind Hive” to Slayer “Show No Mercy”

TOP 100 DEATH METAL GOLD STANDARD ALBUMS OF ALL-TIME. THE UPPER 99.9% OF all-time versus the upper 99.9

GOLDEN AGE OF DEATH METAL Abnormality “Contaminating The Mind Hive” until the next evolution in metallic savage factor occurs….!!

Surgikill “Sanguinary Revelations

Darkness “The Gasoline Solution”

Nervosa “Agony”

Tsjuder “Antiliv”

Winters of Sin “Violence Reigns Supreme”

Warfect “Exoneration Denied”

Nerovsa “Victim of Yourself”

Nervosa “Time Of Death”

Nervosa “2012”

Abnormality “Contaminating The Hive Mind

 

Golden Age of Death Metal  Leviathan”The Tenth Sub Level of Suicide” to “Impiety “Skullfucking Armageddon”  The next stage of Metallic authentic of the Death Metal Age if from

Gravehill “Rites of the Pentgram”

Sinners Burn “Insanity Warmachine”

Necromessiah “Antiklerical Terrorisk Death Squad”

Iperyt “Totalitarian Love Pulse”

Urgeheal  “Goatcraft Torment”

Carpathian Forest “FUCK YOU ALL !!!”

Centurions Ghost “A Sign of the Times”

Nocturanl Breed “Fields of Rot”

Dispiln “Antilife”

Occult “Elegy for the Weak”

Bloodreaping “Ingins Penumbra”

Killaman “Killaman”

Leviathan “The Tenth Sublevel of Suicide”

 

GOLDEN AGE OF DEATH METAL

Impiety “Skullfucking Armaggedon to Occult “Rage to Revenge”

 

Occult “Rage to Revenge

Kings-Evil “Deletion of Humanoise”

Nightside “End of Christianity”

Surrender of Divinity “Oriental Hell Rhythmic”

Vader “Litany”

Impiety “Skullfucking Armageddon”

 

GOLDEN AGE OF DEATH METAL

Cradle of Filth “Pleasures of Evil Made Flesh” to Impiety “Skullfucking Armageddon”

 

Pessiminst “Blood For the Gods”

Ritual Carnage ”

Nile “Amongst The Catacombs of the Nephren-Ka”

Nocturnal Breed “Agressor”

Crown of Thorns “Eternal Death”

Krisiun “Black Force Domain”

Naglfar “Vittra”

Mythos “Pain Amplifier”

Cradle of Filth “Principle of Evil Made Flesh”

 

GOLDEN AGE OF DEATH METAL Slayer “Show No Mercy” to Cradle of Filth “Principle of Evil Made Flesh”

 

Acheron “Rites of the Black Mass”

Decide “Deicide”

Entomed “Left Hand Path”

Bathory “Blood Fire Death”

Slaughter “Strappado”

Exumer “Possessed By Fire”

Destructi0n “Infernal Overkill”

Possesed “Seven Chuches”

Bathory “Bathory”

Slayer “Show No Mercy”

 

GOLDEN AGE OF DEATH METAL July 27th, 1983 to July 27th, 1990 Metallica “Kill ’em All to Deicide “Deicide”

GOLDEN AGE OF EXTREM METAL 1983-1989

…..still a work in progress…..

vanessanocera_thequeenofhorrormetal_520_9959

 

 

vanessanocera_thequeenofmetal_520_9958

 

sharronrazoblademoremetalthanmetal9784675323

 

 

carlaharveykickassmetalhallfoffame2015a99998958795978

 

carlaharveyworldclassvocalistheavymetallegend99996786785432a123123

carlaharveykickassmetalhallofame2015a98958795849846847

 

fernadalirakickassmetalheavymetalhallofamelegend987897897897878

collectorcornertop100heavymetalalltime987987987

kickassmetalcollectorscornerpullthetriggericonickickass987789758985664a23424214

surgikillgodlymajorragersheavymetalhallofame2015@2016

Advertisements