Archives for posts with tag: 30 YEARS OF THE GREATEST HEAVY METAL BAND OF ALL-TIME

 

 

 

 

1980

Coven “Witchcraft Destroys Minds and Reaps Souls”

1981

Coven “Witchcraft Destroys Minds and Reaps Souls”

1982

Coven “Witchcraft Destroys Minds and Reaps Souls”

1983

Mercyful Fate “Melissa”

1984

Mercyful Fate “Melissa”

1985

Mercyful Fate “Melissa”

1986

Mercyful Fate “Melissa”

1987

Mercyful Fate “Melissa”

1988

Mercyful Fate “Melissa”

1989

Mercyful Fate “Melissa”

1990

Deicide “Deicide”

1991

Deicide “Deicide”

1992

Deicide “Deicide”

1993

Deicide “Deicide”

1994

Cradle of Filth “Principle of Evil Made Flesh”

1995

Cradle of Filth “Principle of Evil Made Flesh”

1996

Cradle of Filth “Principle of Evil Made Flesh”

1997

Cradle of Filth “Principle of Evil Made Flesh”

1998

Cradle of Filth “Principle of Evil Made Flesh”

1999

Crest of Darkness “The Ogress”

2000

Crest of Darkness “The Ogress”

2001

Crest of Darkness “The Ogress”

2002

Crest of Darkness “The Ogress”

2003

Crest of Darkness “The Ogress”

2004

Crest of Darkness “The Ogress”

2005

Crest of Darkness “The Ogress”

2006

Crest of Darkness “The Ogress”

2007

Crest of Darkness “The Ogress”

2008

Crest of Darkness “The Ogress”

2009

Crest of Darkness “The Ogress”

2010

Crest of Darkness “The Ogress”

2011

Crest of Darkness “The Ogress”

2012

Crest of Darkness “The Ogress”

2013

Crest of Darkness “The Ogress”

2014

Crest of Darkness “The Ogress”

2015

Crest of Darkness “The Ogress”

2016

Crest of Darkness “The Ogress”

2017

Crest of Darkness “The Ogress”

2018

Crest of Darkness “The Ogress”

 

UNDISPUTED

FOR

THE

19TH

YEAR

IN

A

ROW

700 VOTES

Crest of Darkness

0 Votes

for the 4 top albums of the quarters  Summer 2017, Autum/Fall 2017, Winter 2018, Sprinng 2018

                    No albums between May 12th, 2017 and May 12th, 2018 EVEN came with in a million miles of this GOLD STANDARD, no one even tried. ALL BANDS WITH SELL-OUT ALBUMS IN THERE DISCOGRAPHY ARE DISCARDED BEFORE THE 700 PANEL WAS CONVENED TO VOTE EVERY YEAR. HEAVY METAL BANDS THAT NEVER SOLD-OUT ARE ONLY FOR SERIOUS CONSIDERATION, for your serious Metallic Record Collection. Some bands even if they sell-on be on top 100s of all-time. The Gothic Metal genre does not have the “sell-out” concept to our genre, but in the traditional metal genre, pre Celtic Frost “Into the Pandemonium”  July 1st 1987, as a thrash metal fan, i am a aware of the Slow-down Sindrome. As a 1990’s Heavy Metal Publication, no metal band, very few of the bands formed in the 1980’s, even cut in the 1990,’s most so-called “metal legends” sold-out before the years 1985/1987. With the Death Metal-age Beginning in July 27th, 1990. Heavy Metal officially entered and became a Gothic Metal-age/ Avant-Garde-age/ Death Metal-age-era. 

 

MAY 12TH, 1999 

 TO 

     MAY 12TH, 2029 

        IS 

           THE

             ACTUAL 

                 30 

                    YEARS 

                        OF 

                          THE 

                             GREATEST 

                                HEAVY 

                                  METAL 

                                    BAND 

                                     OF 

                                       ALL-TIME

 

 

 

Coven featuring World-Class Vocalist Jinx Dawson

January 1st 1969 to Present

49 YEARS

This is the longest winning streak of any band in the history of hard rock/ heavy metal to have the same artistic vision they originally started out with, with zero sell-out releases, washed-up out of ideas or going off of the rails

johannasadonisworldclassvocalist1ofthegreatestofall-time89789675465324

jinxdawsonkickassmetalheavymetalhallofamelegend9789797897889

jinxdawson_trailblazerandpioneer_worldclassvocalist666987987976jpg

Motörhead

September 24th, 1977  — June 10, 2016 –to Present

40 YEARS

Mercyful Fate

September 27th, 1982 to Present

35 Years

 

kickassmetallegendsheaymetalartisthtatneversoldout987967

manowarkickassmetalheavymetalhalloffame1983a99987965544777

ManoWaR

August 23rd, 1982 to Present

(….I never heard anyone ever accuse this band of Pulling-a-Metallica….)

manowarthisaintnometallicabullshit989879788765432234fuckyou988787897

manowarthisaintnometallicabullshitmanowargods9789789673241

 

kickassmetalworldclassheavymetal9789879653

 

 

satanmetalgodsneversoldout98797897898a12132

satanintothefirdintothefutureneversoldout-98797878989jpg

satanrulesmetalgodsneversoldout

Satan

October 30th, 1983 to Present

35 Years

kickassmetalsatanbandrulesneversoldout9789789797896754

satancourtintheactkickassmetaslheavymetalhallofame97897897897889

 

Attacker

September 13th 1985 — Present

33 Years

 

chastainmetalgods9789897898765432

Chastain

February 12th, 1985 — PRESENT

33 YEARS

 

chastainmetalgodslegends999909789789679868677564

 

kickassmetalmetallegend879978788798797868543521neversoldout999

Leather Leone

February 12th, 1985 — Present

33 YEARS

 

King Diamond

December 25th, 1985 — Present

33 Years

 

Coven13

Oct0ber 1986 — Present

32 years

 

 

Deicide

June 24th 1900 — Present

28 Years

 

Crest of Darkness

1993–Present

25 YEARS

 

Necrophobic

August 2nd, 1993 — Present

25 Years

 

necrophobicthenocturnalsilence6799679878978865434jpg

 

CRADLE OF FILTH

FEBRUAY 24th, 1994 – present

24 YEARS

 

 

hanzelundgretylworldsgreatestheavymtalbandofalltime98778978978976534

hanzelundgretylmetalgods879789789863241

hanzelundgretylmetalgods89789789789856342123456

Hanzel Und Gretyl

January 1st 1995 to Present

23 Years

IMMORTALS OF METAL

mercyfulfateimmortalsofmetal98797897898767856521

NEVER SOLD OUT

 

Halestorm

1997 to Present

21 Years

halestormmetalgodskickassmetallegends978978978

 

 

christinascabbinametalgodsdess98978989789654362456jpg

Lacuna Coil

February 22nd, 1999 — Present

19 YEARS

 

christinascabbiametallegendmetalgods99878967567453241

 

Arch Enemy

April 25th, 2001 — present

17 YEARS

angelagossowmetallegend9789778978989

 

alissawhitegulzkickassmetallegend97897897897898989

 

crucifiedbarbarametalgodslegends987987978978978

attackerspreadthenewsofsinsoftheworldlikewildfire989786776342343434

crucifiedbarbarakickasmetalheavymetalhalloffamelegend9089876

 

Crucified Barbara

September 21, 2001 — June 14th 2016 — PRESENT

15 YEARS

….EXPECTING A COMEBACK ALBUM AT ONE POINT IN TIME….

IMMORTALS OF METAL

NEVER SOLD OUT

mercyfulfateimmortalsofmetal98797897898767856521

crucifiedbarbararulesfuckyea98978978978987789879

 

livsinheavymetalgoddess87987789789675243

2017livsinheavymetallegend8987987aa3232

 

LIV SIN

JANURAY 1ST 2003 –PRESENT

15 YEARS

livsinkickaassmetallegend98898797897897898png

livsinheavymetallegndgoddess987978978978978

livsinheavymetalherogoddess879897

livsinheavymetallegend8987987978

 

 

The Vision Bleak

February 23rd, 2004 — present

14 Years

 

Sister Sin

January 1st, 2003 — October 27th, 2014

12 Years

NEVER SOLD OUT

IMMORTALS OF METAL

mercyfulfateimmortalsofmetal98797897898767856521

 

 

 

 

Metallica

October 30th, 1982 to October 30th, 1993

11 Years

 

 

 

 

motleycureleatheurrecords9875654a12113

Mötley Crüe

December 15th, 1981 to October 19th, 1991

10 YEARS

 

motleycrueheavymetalhalloffame967975632a214456765686743

 

halloweenkickassmetalhmhslegends987987

HALLOWEEN

OCTOBER 30TH, 1983 TO JULY 27TH 1991

8 YEARS

halloweenbrianthomasworldclassvocalistheavymetalhalloffame9999983a95789598423

heavyhelloweenkickassmetal989789685463432

SLAYER

December 3rd, 1983 to October 9th, 1990

7 YEARS

maragaritamonetthegreatestworldclassvocalistofalltime989789789674

Edge of Paradise

February 1st, 2011 — Present

7 YEARS

EDGE OF PARADISE IS THE WORLD’S GREATEST

HARD ROCK/HEAVY METAL OF ALL-TIME

margaritamonetworldclassvocalistthegreatestvocalistofalltime879879788774354

 

margaritamonetworldclassvocalistgreatestofallitme9879796785645325243345

 

fernandaliragreatestthrashmetalvocalistofallitme987978978976543

Nerovsa

March 1st 2012 to Present

6 Years

prikamaralgreatestthrashmetalguitaristofalltimetop10a987879789798

nervosametallegendsalbumoftheyear201220142016a9879877

nervosathesecondmostimportantdebutinheayvmetalhistoyr98979654

 

 

 

johannasadonisraysheleteigemetallegends987897897654

 

johannasadonismostimportantworldclassvocalsittodsay8987678567456346536446645

Johanna Sadonis/THE OATH/ LUCIFER

July 7th, 2012 — Present

6 YEARS

IN 5 YEARS JOHANNA SADONIS IS THE 5TH MOST IMPORTANT

WORLD-CLASS VOCALIST IN THE HISTORY NOT OF JUST

HEAVY METAL BUT OF ALL MUSIC!!!

johannasadonisworldclassvocalsitmetallegend97899765234345

 

johannasadonisworldclassvocalistlegendmostimportantinmuisc98978978967564652

dismaleuphonyalllitledevilspythonzerogolddiscd52982008a98796985643

anjanatashadismaleuphonymetallegend999999999999999998765541992001

Dismal Euphony (Stavanger, Norway)

OCTOBER 26, 1996 TO JANUARY 27TH, 2001

THE FIRST HEAVY METAL BAND TO BE LEGENDS IN BOTH THE 2OTH AND 21ST CENTURIES, WE CHECK THIS AGAINST ALL 150,000 METAL BANDS KNOW AT THE TIME IN JANUARY 27TH, 2001 

anjanatashametallend98989789765664352a1

dismaleuphonypythonzero12292001a989797865865867553323333

Megadeath

July 20th, 1986 to September 24th, 1990

4 Years

 

 

 

world_class_vocalistspotligt_kickassmetal_heavymetalhalloffame989578875234

We are a GOTHIC METAL/ AVANT -GARDE -age as well as a DEATH METAL age publication. I have been a heavy metal fan since 1978, and one of the first things you notice about 1980’s metal’s artist there were 2 periods in time where the 1980’s metal bands sold-out, 1985 and 1987 are years that stick out thrash metal artist had a sell-out all there own called the SLOW DOWN syndrome. Very few if  any 1980’s bands could cut it in the 1990’s is. When the GOTHIC METAL age and the DEATH METAL age and the AVANT-GARDE METAL age,  metal sellouts happened one after one until AND THERE WERE NO NONE. While GOTHIC METAL does not have the concept of “selling out” or artist are some of the softest and some of the hardest, a lot of my readers who are thrashers. If one is to take serious the concept of band’ selling out, which we do not, just were showing of our acumen and point out the bad journalist by metal publications who refuse to accept there favorite artist are no longer part of HEAVY METAL GOLD STANDARD….THE HIGHER A BAND RANKS HERE, the more we play there CD’s and ALBUMS to determine the album of the year….For example we always thought Metallica were a better artist as a Alternative band from LOAD until Do than they were ever a Metal artist, they are better served as a Alternative Metal band ever than when they were thrash metal hero’s. But since there AlternicA albums are not the GOLD STANDARD albums for he Alternative Metal Genre, we have to say so. Myself I said this is a GOTHIC METAL and a AVANT-GARDE – age as well as a Death Metal age publication, myself I dress in Business Suits and attend Classical Music concerts just as much as I attend Hair Metal, Thrash Metal and Gothic Metal Concerts!!
This is just a insight as to why certain bands are covered here and why other bands rank below the under 99.1 Percentile, they may make out top 100 albums for a quarter or a year, but will not get the enough spins on our turn tables to even qualify for album of the year. Every record review gets 250 spins 21 days time 12 hours, for a accurate reviews. And in October the top 10’s of each album will get 500 hours each for listens to determine the best of the best in song-writing as well as song-writing architecture in terms of compositional excellence at the WORLD-CLASS level, and keep in mind virtuosity is also a key factor, but always keep in mind we always make sure WORLD-CLASS VOCALIST are featured, here as much as possible, and when a band sells out/washes out/ or goes off the rails, we always provide a immediate successor act to follow in there footsteps if a peer is not found. then we move on to the next most vicious metallic act on planet metal. In 2017 metal fans have it better today now, than we ever had in it in the GOLDEN AGE OF HEAVY METAL August 1st, 1981 to October 30th, 1986. 2016 WAS A TOP 5 YEAR IN HEAVY METAL’S HISTORY, on parallel to 1983,1984,1985,1986,1990,1991,1994, 2003. THERE ARE 9 GOLDEN AGES OF HEAVY METAL…and we try to cover each one evenly, but when the World’s GREATEST HEAVY METAL BANDS release albums, they will get the priority coverage…!!! I have work on a few hundred top 100 album of all-time committees, since 1980. And if you were never invited to work here, is because you were never there as a heavy metal fan back in May 1979 or August 1983 like I was, sure I trust and respect my peers….!!! I lived a full live most are trying to recreate, via nostalgia by living in the past, but still goes over everyone’s head that if you want to know about the best artist of a GOLDEN AGE YOUR TRYING TO RECREATE, it is never found on the internet, before the internet every distribution network for record labels had fanzines. Fanzine are a specialized press for RIFF BASED HEAVY METAL  
In this article we will try over the next year to get every KICK*ASS*METAL band on this list !!!! So consider this list as a work in progress

kristinfjellsethpaleforestpalepercetption98978987976532

paleforestmetalgods978978675432

paleforestmetalgods879879789789789787898978

 

 

 

 

 

Advertisements

 

NECK BREAKING NEWS —- MAY 11TH 2018 — 10AM — THE NEW VIDEO Nervosa “Kill The Silence”

is unleashed upon planet metal

TOP 

 100 

   HEAVY 

     METAL 

       ALBUMS 

         OF  

           ALL-TIME

TOP 100 HEAVY METAL ALBUM OF ALL-TIME 20TH & 21ST CENTURY. 100 EACH PER CENTURY, IF IT IS OUT OF PRINT, THEN THE BANDS THAT ARE ACTIVE LIKE NERVOSA are top 100 heavy metal artist of all-time and of the current golden age of true metal which started on August 16th, 2012…..this age was kicked off with Abnormality and Nervosa

ABATTOIR • Vicious Attack
ABNORMALITY • Contaminating the Hive Mind
ABNORMALITY • Mechanisms of Omniscience 
ACCEPT • Restless and Wild
ACID • Acid
ACID • Maniac
ACID • Live in Belgium
AGENT STEEL • Skeptics Apocalypse
AGENT STEEL • Mad Locust Rising
ANACRUSIS • Screams and Whispers
ANNIHILATOR • Alice In Hell
ANTHRAX • Fistful of Metal • Megaforce Records • MRI 069
ANTHRAX • Armed And Dangerous • Megforce Records • MRS 05
ANTRHAX • Spreading The Disease
ANVIL • Metal on Metal
ANVIL • Forged in Fire
ANVIL • Live in Concert
ANVIL CHORUS • Thought Crimes
ANVIL CHORUS • The Killing Sun
ARTILLERY • Fear of Tomorrow
ARTILLERY • Terror Squad
ATHEIST • Piece of Time
ATHEIST • Unquestionable Presence
ATTACKER • Battle At Helms Deep
ATTACKER • The Second Coming
ATTACKER • Standing The Test of Time
ATTACKER • Giants of Canaan
ATTACKER • Sins of the World
AVATARIUM • Avatarium 
AVATARIUM • The Girl With The Raven Mask 
AVATARIUM • Hurricanes and Halo’s 
BATHORY • Bathory
BATHORY • The Return…
BITCH • Damnation Alley
BITCH • Be My Slave
BLACK SABBATH • Mob Rules
BLIND ILLUSION • The Sane Asylum
BLOODLUST • Guilty As Sin
BLESSED DEATH • KILL OR BE KILLED • Megaforce Records • MRI 1369
BLITZKREIG • A TIME OF CHANGES
CACOPHONY • SPEED METAL SYMPHONY
CAGE • Astrology
CANDLEMASS • Nightfall
CANDLEMASS • Ancient Dreams
CANDLEMASS • Tales of Creation
CATHERDRAL • Supernatural Birth Machine
CARNIVORE • Carnivore
CELTIC FROST • Morbid Tales
CELTIC FROST • Emperor’s Return
CELTIC FROST • To Mega Therion
CHASTAIN • Mystery of Illusion
CHASTAIN • Ruler of the Wasteland
CHASTAIN • The 7th of Never
CHASTAIN • The Voice of Cult
CHASTAIN • For those Who Dare
CHASTAIN • In A Out Rage
CHASTAIN • Surrender to No One
CHASTAIN • We Bleed Metal
CHASTAIN • We Bleed Metal17
Children of Technology • Future Decay 
COVEN • Witchcraft Reaps Souls and Destroys Minds
COVEN • Jinx
COVEN13 • Worship New Gods
COVEN13 • Destiny of the Gods
CIRITH UNGOL • Frost and Fire
CIRITH UNGOL • King of the Dead
CRUCIFIED BARBARA • In Distortion We Trust 
CRUCIFIED BARBARA • ‘Til Death Do Us Party 
CRUCIFIED BARBARA • The Midnight Chase 
CRUCIFIED BARBARA • In the Red
CRYPTIC SLAUGHTER • Convicted
CULPPRIT • Guilty As Charged
CYNIC • Focus
DARK ANGEL • We Have Arrived
DARK ANGEL • Darkness Descends
DARK ANGEL • Leave Scars
DEAF DEALER • Keeper of The Flame
DEF DEALER • Journey Into Fear
DARKNESS • The Gasoline Solution
DEATH • Scream Bloody Gore
DEATH • Leprosy
DEATH • Spirtual Healing
DEATH • Human
DEATH • Individual Thought Patterns
DEATH • Symbolic
DEATH ANGEL • Act III
DEATH STRIKE • Fuckin’ Death
DEEP SWITCH • Nine Inches of God
DEMONA • Metal Through The Time 
DEMONA • Speak With The Devil
DESTRUCTION • Infernal Overkill
DESTRUCTION • Under Attack
DESTUCTOR • Maximum Destruction
DREAM DEATH • Journey Into Fear
DOCTOR BUTCHER • Doctor Butcher
DORO • Fist In The Air 
EDGE OF PARADISE • Mask
EDEGE OF PARADISE • Perfect Shade of Grey
EDGE OF PARADISE • Immortal Waltz
EDGE OF PARADISE • Alive
EXCITER • Heavy Metal Maniac
EXCITER • Violence & Force • Megaforce Records
EXCITER • Exciter • Double Play Classic • Heavy Metal Maniac • Violence & Force • 1989 CD —Caroline/Megaforce Records
EXHORDER • Slaughter In the Vatican
EXODUS • A Lesson in Violence • October 30th, 1984 Advance Cassette
EXODUS •Bonded By Blood
EXODUS • Pleasure of the Flesh
EXODUS • A Lesson In Violence (Live @ Studio 54 + March 1986 Paul Baloff Demos)
EXODUS • Another Lesson In Violence LIVE
EXODUS • Bonded By Baloff (A.L.I.V Remastered + Bonus Tracks)
EXUMER • Possessed By Fire
EXUMER • Rising By The Sea
FATES WARNING • Night On Brocken
FORBIDDEN • Forbidden Evil
FORBIDDEN • Twisted Into Form
The GATHERING • Mandylion
The GATHERING • Nightime Birds
GRAVE DIGGER • Heavy Metal Breakdown • Megaforce Records
• MRI 869
GRAVE DIGGER • Witch Hunter • Megaforce Records • MRI 1169
GRIFFIN • Flight of The Griffin
HAWAII • One Nation Underground
HALLOWEEN • Don’t Metal With Evil • October 30th, 1984 Advance Cassette Original Artwork
HALLOWEEN • Don’t Metal With Evil
HALLOWEEN • No One Gets Out!
HALLOWEEN • No One Gets Out! • Molten Metal Records Version features the “Vicious” Demo
H-BOMB • Coup de metal
H-BOMB • Attaque
HELL • “Hell” 1982 CD Demos Come on 2011 CD album
HELLION • Screams in the Night
HELLION • The Black Book
HELLION • Will Not Go Quietly
HELLION • To Hellion And Back
HEATHEN • Breaking The Silence
HEATHEN • Victims of Deception
HEATHEN • Recovered
HIRAX • Raging Violence
HIRAX • Not Dead Yet (Raging Violence) on CD
HOLOCAUST • The Nightcomers
ICE AGE * Breaking The Ice
IMAGIKA • Imagika
IMAGIKA • Worship
IMAGIKA • And So It Burns
Imagika • Devil on Both Sides
Infernäl Mäjesty • None Shall Defy
Infernäl Mäjesty • No God
INSANITY • Death After Death
IRON MAIDEN • Iron Maiden
IRON MAIDEN • Killers
IRON MAIDEN • The Number of the Beast
JAGUAR • Power Games
JAG PANZER • Ample Destruction
JUDAS PREIST • Killing Machine
JUDAS PRIEST • Hell Bent for Leather
JUDAS PRIEST • Unleashed In the East
JUDAS PRIEST • British Steel
JUDAS PRIEST • Painkiller
KING DIAMOND • Fatal Portrait
KING DIAMOND • Abigail
KING DIAMOND • Them
KREATOR • Endless Pain
KREATOR • Pleasure To Kill
LADY BEAST • Lady Beast 
LADY BEAST • Lady Beast II
LADY BEAST •Metal Immortal 
LADY BEAST • Vicious Breed 
LEATHER LEONE • Shock Wave
LEATHER LEONE • II
LIEGE LORD • Master Control
LUCIFER • Lucifer I
LUCIFER • Lucifer II
MACABRE • Gloom
MALEDICTION • Condamnés
MALEDICTION • Esclave du vice
MANOWAR • Battle Hymns
MANOWAR • Into Glory Ride • Megaforce Records
MANOWAR • Hail To England
MASSACRE • From Beyond
MASSACRE • Back From Beyond
MASTER • Master
MASTER • 1985 Unreleased Album
MEDIEVAL • Medieval…aka 1983 Medieval Cassette Album
MEDIEVAL • All Knobs to the Right
MEDIEVAL • Reign of Terror
MEDIEVAL • Medieval Kills
MEGADETH • Rust In Peace
The MENTORS • You Axed For It
MERCYFUL FATE • 1982 EP
MERCYFUL FATE • Melissa
MERCYFUL FATE • Don’t Break The Oath
MERCYFUL FATE • Curse of The Pharaohs
MERCYFUL FATE Live From The Depths of Hell
MERCYFUL FATE • The Beginning
MERCYFUL FATE • Return of the Vampire
MERCYFUL FATE • In The Shadows
METAL CHURCH • Metal Church • Ground Zero Records with Bonus Track “Big Guns”
METAL CHURCH • Metal Church 1986 • CD on Elektra Records (C)1984 (P) 1986
METALLICA • Kill em ‘ All • Megaforce Records • MRI 069
METALLICA • Ride The Lightning • Megaforce Records • MRI 769
METALLICA • Whiplash • Megaforce Records • MRS 04
METALLICA • Creeping Death/Jump In the Fire Cd
METALLICA • Master of Puppets
MORBID ANGEL • Abominations of Desolation
MORBID ANGEL • Altars of Madness
MORBID ANGEL • Blessed are the Sick
MORBID ANGEL • Covenant
MORBID ANGEL • Domination
MORBID ANGEL • Entangled In Chaos
Motörhead • Ace of Spades
Motörhead • N Sleep ’til Hammersmith
Motörhead • Iron Fist
Motörhead • Another Perfect Day
Motörhead • No Remorse
Motörhead • Orgamsatron
MindMaze • Mask of Lies 
MindMaze • Back From the Edge 
MindMaze • Resolve 
NASTY SAVAGE • Nasty Savage
NASTY SAVGE • Indulgence
NERVOSA • 2012
NERVOSA • Time of Death
NERVOSA • Victim of Yourself
NERVOSA • Agony
NERVOSA • Downfall of Mankind
NIGHTMARE • Astral Deliverance
Nightwish • Once 
OBITUARY • Slowly We Rot
OBITUARY • Cause of Death
OBLIVION • From This Day Forward
OVERKILL • Feel The Fire • Megaforce Records • MRI 1469
OZ • Fire in The Brain
OZ • III Warning
OZZYOSBOURNE• Blizzard of Ozz
OZZY OSBOURNE • Diary of a Madman
OZZY OSBOURNE • Tribute
PAGAN ALTAR • 1982 Demo Cassette
PAGAN ALTAR • Pagan Altar Volume 1
PAGAN ALTAR • Judgment of the Dead
PILE DRIVER • Metal Inquisition
PENTAGRAM • Pentagram
PENTAGRAM • Day of Reckoning
PENTAGRAM • Relentless • Pentagram retitled
PENTAGRAM • Day of Reckoning/Relentless • Double CD
PENTAGRAM • Be Forewarned
POSSESSED • Seven Churches
RAVEN • All for One • Megaforce Records • MRI 269
RAVEN • Live at the Inferno • Megaforce Records • MRI 969
RAZOR • Executioners’ Song
RAZOR • Evil Invaders
REPULSION • Slaughter of the Innocent
REPULSION • Horrified
RIOT • Fire Down Under
RIOT • Thundersteel
RIOT • Privilege of Power
The RODS • Wild Dogs
RUSH • A Far Well To Kings
RUSH • Permanent Waves
RUSH • Exit…Stage Left
RUSH • Signal
RUSH • Grace Under Pressure
RUSH • Power Windows
RUSH • Hold Your Fire
RUSH • A Show of Hands
RUSH • Chronicles
RUSH • Presto
RUSH • Test For Echo
RUSH • Differnet Stages — LIVE
SABBAT • History of a Time to Come
SATAN • Court in the Act
SATAN • Suspended Sentence
SATAN • Live in the Act
SATAN • Life Sentence
SATAN • Trial By Fire –Live In North America
SATAN • Atom by Atom
SAVAGE MASTER • Mask of the Devil 
SAVAGE MASTER • With Whips and Chains 
SAVATAGE • Sirens
SIGN OF THE JACKAL • Mark of the Beast 
SIGN OF THE JACKAL • Breaking The Spell
SCORPIONS • Taken By Force
SACRIFICE • Torment In Fire
SACRIFICE • Forward to Termination
SACRIFICE • Soliders of Misfortune
SACRIFICE • Apocalypse Inside
SEPULTURA • Beneath The Remains
SKULLVIEW • Kings of the Universe
SINDROME • Sindrome 2 demos on 1 CD
SINDROME • Resurrection….
SLAUGHTER • Strappado
SLAUTER XSTROYES • Winterkill
SLAUTER XSTROYES • Free the Beast
SLAYER • Show No Mercy
SLAYER • Haunting The Chapel
SLAYER • Hell Awaits
SLAYER • Live Undead
SLAYER • Reign in Blood
SODOM • In The Sign of Evil
SODOM • Obsessed By Cruelty
STORMTROOPERS OF DEATH • Speask English of Die • Megaforce Records
SUCIDIAL TENDENCIES • Suicidal Tendencies
SYRIS • Unseen Forces
TANK • Filth Hounds of Hades
TANK • Power of the Hunter
TANK • This Means War
TERRORIZER • World Downfall
TESTAMENT • Legacy
TROUBLE • Trouble • Later retitled Psalms 9
TROUBLE • The Skull
TROUBLE • Run To The Light
TYGERS OF PAN TANG • Wildcat
TYGERS OF PAN TANG • Spell Bound
TWISTED SISTER • Under the Blade
UFO • The Wild, The Willing, The Innocent
UNSEEN TERROR • Human Error
VAINGLORY Vainglory
VICIOUS RUMORS Soliders of the Night
VICIOUS RUMORS Digital Dictator
VENOM • Welcome to Hell
VENOM • Black Metal
VENOM • At War With Satan
VIO-LENCE • Eternal Nightmare
VOI VOD • War and Pain
VOI VOD • Rrröööaaarrr
WALK IN DARKNESS • In the Shadow of Things
WALK IN DARKNESS • Welcome to the New World
WARGASM • Why Play Around?
WARFARE • Pure Filth
WARFARE • Metal Anarchy
WARFARE • Mayhem Fucking Mayhem
WARLOCK • Triumph and Agony
WARLORD • Deliever Us
WARLORD • And the Cannons of Destruction Have Begun
WARLORD • Thy Kindgom Come • 1st EP and LP on CD
WARHEAD • Speedway
WARHEAD • The Day After
WATCHTOWER • Energetic Disassembly
WATCHTOWER • Control and Resistance
WILDESTARR • Arrival
WILDESTARR • A Tell Tale Heart
WILDESTARR • Beyond The Rain
Witchcross • Witchcross
WITCHCROSS • Innocent & Evil
WITCHCROSS • Crypt of The Undead
WITCHCROSS • Cauldron In Satan’s Shadow
WITCH CROSS • Fit for Fight
WITCH CROSS • Axe to Grind
WITCHFINDER GENERAL • Death Penalty
WITCHFINDER GENERAL • Friends of Hell
WICHKILLER • Day of the Saxons
ZOSER MEZ • Vizier of Wasteland

 

Biography

NERVOSA is endorsed by:

– Kramer Guitars
http://www.kramerguitars.com

– Pedrone amplifier
http://www.pedroneshop.com

– DR Strings
http://www.drstrings.com

– Aristides Instruments
http://www.aristidesinstruments.com

– Ed’s MoD ShoP Custom Pedals
http://www.edsmodshop.com

– Romanelli Tattoo
http://www.facebook.com/rafaelromanelli

– Espaço Som Studio
http://www.espacosom.com.br

– Aline Knox Tattoo
https://www.facebook.com/aline.knox

– Contra Grife Camiseteria
http://www.facebook.com/contragrife

– JDuarte Design
http://www.jduartedesign.com

– Tiaflex Cables
http://www.tiaflex.com.br

– JCS handmade
https://www.facebook.com/fernando.nobile.1

– Paiste Cymbals
http://www.paiste.com/

NERVOSA is:

Fernanda Lira – Bass and Lead Vocals

Prika Amaral – Guitar and backing vocals

Luana Dametto – Drums

TOP 

 100 

   ALBUMS 

    OF 

      THE 

         DEATH 

             METAL 

                AGE 

 

 

 Abnormality * Contaminating The Hive Mind * 2012

Acheron * Rites of The Black Mass

Annihilator * Alice in Hell

Assassin * The Upcoming Terror

Bathory * Blood Fire Death

Bathory * Under the Sign of the Black Mark

Bestial Warlust * Blood and Valour

Bloodreaping * Ignis Penumbra

Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!

Centuions Ghost * A Sign of Things To Come

Chemicaust “Unleshed Upon This World”

Coroner * RIP

Cradle of Filth * The Principle of Evil Made Flesh * 1994

Cradle of Filth * V Empire * 1996

Cradle of Filth * Dusk…and Her Embrace * 1996

Cradle of Filth * Cruelty and The Beast * 1998

Cradle of Filth * From The Cradle To Enslave * 1999

Cradle of Filth * Midian * 2000

Cradle of Filth * Bitte Suites To Succubi * 2001

Cradle of Filth * Damnation and a Day * 2003

Cradle of Filth * Nymphetamine * 2004

Cradle of Filth * Thornography * 2006

Cradle of Filth * Godspeed on The Devil’s Thunder * *2008

Cradle of Filth * Darkly, Darkly, Venus Aversa * 2010

Cradle of Filth * Midnight On The Ladybrinth * 2012

Cradle of Filth * The Manticore and Other Horrors * 2012

Crest of Darkness (NORWAY) * The Ogress

Crest of Darkness (NORWAY) * Project Regeneration

Crown of Thorns (Sweden) * Eternal Death

Dark Angel * Darkness Descends

Darkness “The Gasoline Alley” 

Death * Scream Bloody Gore

Death Angel * The Ultra- Violence

Degial “Predators Reign” 

Destruction * Infernal Overkill

Deströyer 666 *Unchain The Wolves

Deströyer 666 * Phoenix Rising

Deströyer 666 * Cold Steel…for a Iron Age

Deströyer 666 * Defianc

Deströyer 666 * Wildfire

Deicide * Deicide

Disiplin (NORWAY) * Anti-Life

Dismember * Like a Every Flowing Stream

Entomed * Left Hand Path

Exodus * Bonded By Blood

Exumer * Possessed By Fire

Exumer * Rising By The Sea

Fleshcrawl * Bloodred Massacre

Gravehill * Rites of the Pentagram * 2009

Hellcannon * Infected With Violence

Impiety * Skullfucking Armeggedon

Impiety Koas Kommand 696

Internal Bleeding * Vocarcious Contempt

Iperyt * Totalitarian Love Pulse * 2007

Killaman * Killman

Kings Evil * Deletion of Humanoise

Kreator * Pleasue TO Kill

Krisiun * Black Force Domain

Leviathan * The Tenth Sublevel of Suicide

Massacra (FRANCE) * Final Holocaust

Massacre * From Beyond

Metallica * Kill em All

Metallica * Ride The Lightning

The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013

Morbid Angel * Altars of Madness

Mythos * Pain Amplifier

Nercodeath * Into the Macabre

Necromessiah * Antiklerikal Terroristik Deathsquad

Nervosa * 2012

Nervosa * Time of Death

Nervosa  * Victim of Yourself 

Nervossa * Agony

Nervosa  * “Downfall of Mankind”

Nightside * The End of Christianity

Nile * Amongst The Catacombs of Nephren Ka

Nocturnal Breed (NORWAY) * Agressor

Nocturnal Breed (NORWAY) * Fields of Rot

Nocturnus * The Key

Nuclear Assault * Game Over

Occult * Of Fleash and Blood

Occult * Elegy For The Weak

Pessimist * Blood For The Gods

Pestilence * Malleus Maleficarum

Possessed * Seven Churches

Onslaught * The Force

Rabelliun (BRAZIL) * Burn The Promise Land

Ritual Carnage * The Highest Law

Sabbat * (NIPPON) * Envenom

Sabbat * (NIPPON) * Envoke

Sabbat * (NIPPON) * Disembody

Sabbat * (NIPPON) *Fetishism

Sabbat * (NIPPON) *Karisma

Sabbat * (NIPPON) *Satanasword

Sabbat * (NIPPON) * Karmagmassacre

Sabbat * (NIPPON) * …And the Sabbatical Queen

Sabbat * (NIPPON) * To Praise the Sabbatical Queen

Sabbat * (NIPPON) *Sabbatrinity

Sabbat * (UNITED*KINGDOM) * History of a time to Come

Sadus * Swallowed in Black

Sepultura * Beneath The Remains

Slayer * Show No Mercy

Slayer * Haunting The Chapel

Slayer * Hell Awaits

Slayer * Live Undead

Slayer * Reign In Blood

Sinners Burn (Sweden) * Insanity Warmachine * 2010

Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007

Surrender of Divinity * Oriental Hell Rhythmic

Surgikill “Sanguinary Revelations

Urgehal * Goatcraft Torment *

Warfect * Exoneration Denied * 2013

Walhalla * Firereich

Vader * The Ultimate Incantation

Vader * Litnay

Vaultwraith “Death Is Proof of Satans Power”

 Voi Vod * War and Pain

Zyklon (NORWAY) * Aeon

 

 

 

 

 

 

 

 

 

 

 

Helnea Khilstrand Specht * Ice Age Original Bassist

Proudly Displays the

2017 Heavy Metal Debut Album of the Year Winner

Ice Age “Breaking The Ice” October 20th, 2017

Helana Khilstand Specht was the Original Bassist on the debut demo in

1986, and KICK ASS METAL inducts the whole band of its vintage-era, in to the KICK ASS METAL Heavy Metal Hall of Fame.

Helnea has always been a KICK ASS METAL Heavy Metal Hall of Fame Member.

The very first heavy metal hall of fame i ever built was in September 20th, 1980. As all 13 year old men do when they first here Ozzy Osbourne, Tygers of Pan Tang , Iron Maiden….etc

As the genre grew, i wanted the KICK ASS METAL HEAVY METAL HALL OF FAME

ASPECT TO GROW ALSO.

I wanted to say even if this band never released a album they would be inducted into this KICK ASS METAL HEAVY METAL HALL OF FAME……!!!!

Because 2 of the greatest live bands i have ever seen never released a album….so our guidelines are different from other metallic hall of fames!!!!!

Since this album Ice Age “Breaking the Ice” was released on October 20th, 2017, the last 75 days of 2017 are going to be very uncomfortable for everyone on Planet Metal, since there Balls to the Walls coverage on this historic event on heavy metal history.

Notice on our facebook page how the top photo has never been changed when were known to change it every 12 hours……it will be changed on January 1st, 2018….because we will never forget what the world happened in 2017….JUST WELCOME TO THE ICE AGE…..!!!!!!!!!!!!

BEST DEBUT ALBUMS IN 1980’S HEAVY METAL —1980-2017

2017 Ice Age “Breaking the Ice”

 

2016 Surgikill * Sanguinary Revelations

2015 Lucifer * Lucifer I

2014 Nervosa * Victim of Yourself.

2013 Latern * Below

2012 Abnormality * Contaminating the Mind Hive

2011 The Konsortium * The Konsortium

2010 Triypkon * Eparistera Daimones

2009 FEN* The Malediction Fields

2008 Hail of Bullets…of Frost and Blood

2007 Slavia * Strength and Vision

2006 Iperyt * Totalitarian Love Pulse

2005 Crucified Barbara * In Distortion we trust

2004 The Amenta * Occasus

2003 Disiplin (NORWAY) * Disiplin

2002 Bloodbath * Resurrection Through Carnage

2001 Dragonlord * Rapture

2000 Hypnosia * Extreme Hatred

1999 The Kovenant * Animatronic

1998 Ritual Carnage * The Highest Law

1997 Nocturnal Breed * Agressor

1996 Impiety * Asateerul Awaleen

1995 Usurper * Diabolosis

1994 Cradle of Filth * The Principle of Evil Made Flesh

1993 Necrophobic * The Nocturnal Silence

1992 Incantation * Onward to Gologatha

1991 Dismember * Like A Ever Flowing Stream

1990 Deicide * Deicide

1989 Morbid Angel* Altars of Madness

1988 Sabbat * History of A Time To Come

1987 Death * Scream Bloody Gore.

1986 Exumer * Possessed By Fire

1985 Exodus * Bonded By Blood

1984 Bathory * Bathory

1983 Slayer * Show No Mercy

1982 Tank * Filth Hounds of Hades

1981 Venom * Welcome To Hell

1980 Tygers of Pan Tang * Wildcat

TOP 150 HEAVY METAL ALBUMS OF ALL-TIME LIST IN THE TRADTIONAL METAL GENRE…THE VERY 1ST HEAVY METAL album was released on Friday the 13th, February 13th, 1970 Black Sabbath “Black Sabbath”.  And these are gold standard albums and the best of the best it is alphabetical order. !!!  

Abattoir- Vicious Attack

Accept- Restless and Wild

Acid- Acid

ACID * MANIAC

Agent Steel- Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis- Screams and Whispers

ANGEL DUST- INTO THE DARK PAST

Angel Witch * Angel Witch

ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland

ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS

Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…

Anvil- Metal on Metal

ANVIL- FORGED IN FIRE

Anvil- Live in concert

Anvil-Worth the weight

ANVIL CHORUS * THOUGHT CRIMES

Anvil Chorus * The Killing Sun

Artillery * Fear Of Tomorrow

ARTILLERY * TERROR SQUAD

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

ATTACKER * BATTLE AT HELM’S DEEP

ATTACKER * THE SECOND COMING

ATTACKER * GIANTS OF CANAAN

ATTACKER * SINS OF THE WORLD

BATHROY * BATHORY

Bathory * The Return…

Bitch * Damnation Alley

Bitch- Be My Slave

Black Flag “Damaged”

Black Flag “My War”

Black Flag “Slip It In”

Black Flag “Live ’84”

Black Flag “Loose Nut”

Black Flag “In My Head”

Black Flag “Who’s Got the 10/2”

Black Sabbath- Mob Rules

BLIND ILLUSION- THE SANE ASYLUM

BLOODLUST “GUILTY AS SIN”

BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS

BLITZKRIEG * A TIME OF CHANGES

CACOPHONY- SPEED METAL SYMPHONY

Candlemass-Nightfall

Cage- Astonomy

Cathedral- Supernatural Birth Machine

CELTIC FROST- MORBID TALES

Celtic Frost- Emperors Return

Celtic Frost- To Mega therion

CELTIC FROST- INTO THE PANDEMONIUM

Chastain * Mystery of Illusion

Chastain * Ruler of the Wasteland

Chastain * The 7th of Never

Chastain * The Voice of Cult

Chastain- For those who Dare

CHASTAIN- IN A OUTRAGE

COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE

Coven * Jinx

COVEN13 * Worship New Gods

CIRITH UNGOL * FROST AND FIRE

CIRITH UNGOL * KING OF THE DEAD

Crimson Glory- Crimson Glory

CRYPTIC SLAUGHTER * CONVICTED

Culprit- Guilty As Charged

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld

DARK ANGEL * DARKNESS DESCENDS

DARK ANGEL * LEAVE SCARS

DEF DEALER * KEEPER OF THE FLAME

DEF DEALER * JOURNEY INTO FEAR

DEATH- SCREAM BLOODY GORE

DEATH * LEPORSY

DEATH- SPIRITUAL HEALING

DEATH- HUMAN

DEATH-INDIVIDUAL THOUGH PATTERNS

DEATH * Symbolic

Death Angel- The Ultra-Violence

Death Angel “Frolic Throgh the Park

DEATH ANGEL- ACT III

Death Strike-Fuckin’ Death

Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe

Ded Engine * Hot Shot

Ded Engine * Hold A Grudge

Deep Switch- Nine inches of God

DESTRUCTION- INFERNAL OVERKILL

DESTRUCTOR “MAXIMUM DESTRUCTION”

Détente “Recognizne No Authority”

Détente “Decline”

Diamond Head * Diamond Head…1980 …aka Lightning to the Nations

Diamond Head- Lightning to the Nations

Diamond Head- Behold the Beginning

Discharge * Hear Nothing, See Nothing, Say Nothing

Dream Death- Journey Into Mystery

DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC

Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS

EXCITER  HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

Exhorder- Slaughter in the Vatican

EXODUS- A LESSON IN VIOLENCE-  October 31st, 1984 1984 ADVANCE CASSETTE

EXODUS- BONDED BY BLOOD

EXODUS- PLEASURES OF THE FLESH

EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)

EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)

Exorcist * Nightmare Theatre

EXUMER * POSSESSED BY FIR

FATES WARNING * NIGHT ON BROKEN

Fear of God * Within The Veil

FORBIDDEN- FORBIDDEN EVIL

FORBIDDEDN * TWISTED INTO FORM

THE GATHERING * MANDYLION

THE GATHERING * NIGHTTIME BIRDS

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS

GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS

THE GREAT KAT- WORSHIP ME OR DIE!

THE GREAT KAT- BEETHOVEN ON SPEED

Griffin- Flight of the Griffin

Hawaii- One Nation Underground

HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK

HALLOWEEN- DON’T METAL WITH EVIL

HALLOWEEN “NO ONE GETS OUT!”

HALLOWEEN “NO ONE GETS OUT!” MOLTEN METAL RECORDS PRESSSING/ with the Vicious Demo”

Hell- Hell (1982/1986 compilation )…Demos come with 2 disc version of 2011 debut CD

H-Bomb- Attaque

HEATHEN- BREAKING THE SILENCE

HEATHEN- VICTIMS OF DECEPTION

HEATHEN-RECOVERED

HIRAX- RAGING VIOLENCE

HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD

HOLOCAUST- THE NIGHTCOMERS

Ice Age “Breaking the Ice”

Insanity- Death after Death

IRON MAIDEN- IRON MAIDEN

IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games

JAG PANZER- AMPLE DESTRUCTION

Judas Priest * Killing Machine

Judas Priest * Hellbent for Leather * aka Killing Machine

JUDAS PREIST * UNLEASHED IN THE EAST

Judas Priest- British Steel

Judas Priest- Painkiller

King Diamond-Fatal Portrait

King Diamond- Abigail

King Diamond- Them

Kreator- Endless Pain

Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom

Malediction- Condamnes

Manowar * Battle Hymns

MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS

MANOWAR * HAIL TO ENGLAND

Manowar * Sign of the Hammer

Manowar “Fighting The World”

Manowar “Kings of Metal”

Massacre- From Beyond

MASSACRE “BACK FROM THE DEAD”

MASTER- MASTER

MASTER- 1985 ALBUM UNRELEASED

MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album

Medieval- ALL KNOBS TO THE RIGHT

MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP

MEDIEVAL- MEDIEVAL KILLS

MEDIEIVAL “DEMOS” 2010 CD AMTEX/ MEDIEVAL — SELF REALIZED

MEGADETH- RUST IN PEACE

MENTORS “YOU AXED FOR IT”

MERCYFUL FATE-  “Mercyful Fate” November 25th, 1982 EP

MERCYFUL FATE- MELISSA

MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS

MERCYFUL FATE- THE BEGINNING

MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS

METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP

METALLICA- NO LIFE TIL LEATHER

METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview

METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end, but during remastering the sound was speed-up for the effect of extra heaviness/ savage factor.

METALLICA- KILL EM ALL * MEGAFORCE RECORDS

Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS

Metallica- Creeping Death/ Jump in the Fire CD

Metallica- Master of Puppets

Morbid Angel- ABOMINATIONS OF DESOLATION

MORBID ANGEL- ALTARS OF MADNESS

MORBID ANGEL BLESSED ARE THE SICK

MORBID ANGEL * COVENANT

MORDBID ANGEL * DOMINATION

MORBID ANGEL* ENTANGLED IN CHAOS

Mötley Crüe “Too Fast for Love” December 15th, 1981 Leathür Records Pressing

Mötley Crüe “Shout At the Devil”

Motörhead – Ace of Spades

MOTORHEAD- NO SLEEP TIL HAMMERSMITH

Motorhead * Iron Fist

Motörhead  * Another Perfect Day

Motörhead * No Remorse

Motörhead * Orgasmatron

Nasty Savage- Nasty Savage

NASTY SAVAGE- INDULGENCE

NERVOSA were originally THE 4 HORESMAN OF THE APOCALYPSE….ala, Metallica 1982/1986 …..

Prika Amaral * Fernanda Lira * Fernanda Terra * Karen Ramos

NERVOSA * 2012

nervosa2012top100heavymetalhalloffamealbumsofalltimemetalgodslegends9768967875463

NERVOSA * TIME OF DEATH

nervosaterraamaralliraeraheavymetalhalloffamemarch2012a999877771

NERVOSA * VICTIM OF YOURSELF

nervosavictimofyourselftop100heavymetalalbumofalltime5a9879876661

nervosavictimofyourselfkickassmetalheavymetallegends8797896785667465344

 

NERVOSA * AGONY

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

nervosaheavymetalgodslegends98797896772341413431242323423

amaral-dametto-lira-eranervsoaheavymetallegnds98796786757543523424233523423423

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

NME * UNHOLY DEATH

Nuclear Assault “Game Over”

OBITUARY * SLOWLY WE ROT

OBITUARY * Cause of Death

Obilevon * From this Day Forward

Obliveon * Nemesis

ONSLAUGHT- THE FORCE

Onslaught * Power From Hell * 1987 Combat Records Version

Original Sin * Sin Will Find You Out

OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS

OZ- Fire in the Brain

OZ – III Warning

Ozzy Osbourne- Blizzard of Ozz

Ozzy Osbourne-Diary of a Madman

Ozzy Osbourne “Tribute”

Pagan Altar * 1982 Demo Cassette

Pagan Altar- Pagan Altar Volume 1

PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1

PILE DRIVER- METAL INQUISITION

PILE DRIVER * STAY UGLY

Pentagram- Pentagram

Pentagram- Day of Reckoning

Pentagram * Relentless 1985 debut Retitled

Pentagram- Be forewarned

POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop

RAVEN * Wiped Out

RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS

RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS

RAZOR- EXECUTIONERS SONG

RAZOR- EVIL INVADERS

REPULSION * SLAUGHTER OF THE INNOCENT

REPULSION – HORRIFIED

Riot- Fire Down Under

Riot- Thunder Steel

Riot- Privilege of Power

The Rods “Wild Dog”

RUSH * A FARWELL TO KINGS

RUSH * PEMANENT WAVES

RUSH- MOVING PICTURES

RUSH * EXIT…STAGE LEFT

RUSH- SIGNALS

RUSH- GRACE UNDER PRESSURE

RUSH- POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * PRESTO

RUSH * CHRONICLES

RUSH * TEST FOR ECHO

RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME

SABBAT ( NIPPON) * ENVENOM

SABBAT ( NIPPON) * EVOKE

SABBAT ( NIPPON) * DISEMBODY

SATAN * INTO THE FIRE * November 17th, 1982 CASSETTE DEMO

SATAN- COURT IN THE ACT

SAVATAGE * Sirens

SAVATAGE * The Dungeons are Calling

Scorpions- Taken By Force

SACRIFICE- Torment in Fire

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLIDERS OF MISFORTUNE

SACRIFICE * APOCALYPSE INSIDE

Sentinel Beast “Depths of Death”

Sentinel Beast “Up From the Ashes

SEPULTURA “Morbid Visions”

Sepultura “Schizophernia”

SEPULTURA- BENEATH THE REMAINS

Skullview- Kings of the Universe

Sindrome- Sindrome (2 demos on CD) * May 12th, 1999 BRUTAL RECORDS PRESSING

SINDROME “RESURRECTION……”

SLAUGHTER- STRAPPADO

SLAUTER XSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER- SHOW NO MERCY

SLAYER- HAUNTING THE CHAPEL

SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS

SLAYER “REIGN IN BLOOD”

SLAYER “SOUTH OF HEAVEN”

SLAYER “SEASONS OF THE ABYSS”

SLAYER “DECADE OF AGRESSION”

SODOM * IN THE SIGN OF EVIL

SODOM * OBSESSED BY CRUELTY

STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades

Tank- Power of the Hunter

TANK- THIS MEANS WAR

TERRORIZER-WORLD DOWNFALL

Testament- The Legacy

THRUST * Fist Held High

TROUBLE * LIVE * May 2nd, 1983 CASSETTE ON METAL ENTERPRISES

TROUBLE- PSALMS 9

TROUBLE * THE SKULL

TYGERS OF PAN TANG- WILD CAT

Tygers of Pan Tang- Spell Bound

TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent

Unseen Terror- Human Error

Venom- Welcome to Hell

Venom- Black Metal

Venom * At War with Satan

VICIOUS RUMORS * Soldiers of the Night

VICIOUS RUMORS * Digital Dictator

VIO-LENCE * ETERNAL NIGHTMARE

Voi Vod- War and Pain

Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?

Warfare * Pure Filth

WARFARE-METAL ANARCHY

Warfare * Mayhem Fucking Mayhem

Warlock * Burning The Witches

Warlock * Hellbound

Warlock * True As Steel

WARLOCK “TRIUMPH AND AGONY”

Warlord-Deliver Us

Warlord * And The Cannons Of Desturuction Have Begun

Warlord * Thy Kingdom Come * 1st EP and LP on CD

Warhead * Speedy Way

WARHEAD- THE DAY AFTER

Warning- Aftermath …contains the August 23rd, 1985 “NOT A CHANCE IN HELL DEMO”

WATCHTOWER- ENERGETIC DISASSEMBLY

WASP “WASP” * August 17th, 1984

Wildestarr * Arrival

WITCH CROSS- FIT FOR FIGHT

Witchcross “Witchcross”

Witchcross “Innocence and Evil”

WITCHCROSS “CRYPT OF THE DEAD”

WITCHFINDER GENERAL- DEATH PENALTY

WITCHFINDER GENERAL- FRIENDS OF HELL

Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

THIS NECKBREAKING NEWS FEATURE IS COURTESY OF RoadrunneR/Blabbermouth News Service

Death metal GODS AND HEAVY METAL LEGENDS MORBID ANGEL will UNLEASH upon planet metal their new album, “Kingdoms Disdained”, on December 1 via UDR Music. Recorded at Mana Recording in St. Petersburg, Florida with producer — and former MORBID ANGEL guitarist — Erik Rutan, the LP marks the band’s first release with drummer Scott Fuller (ANNIHILATED, ex-ABYSMAL DAWN) who joined MORBID ANGEL last year following the departure of Tim Yeung. It is also be MORBID ANGEL’s first album to feature bassist/vocalist Steve Tucker since 2003’s “Heretic”.

“Kingdoms Disdained” will include the song “Warped”, which MORBID ANGEL performed live on its recent U.S. tour.

Tucker, who is back for his third spell with the group, told “The Metal Magdalene With Jet” show about MORBID ANGEL’s approach on the upcoming album: “It was really just about writing music — it was just about writing a MORBID ANGEL album. Nobody said, ‘Hey, we wanna go in this direction,’ nobody said anything. I mean, there’s obvious things there. I’ve said it before — I’m a death metal guy, so, for me, it’s gonna be a death metal album; if I’m on it, it’s death metal. So it was just about making a MORBID ANGEL album. It was really about coming in with something new, something fresh, but yet it still being MORBID ANGEL. Really, honestly, we didn’t approach this any differently than any of the other albums I was involved in except for maybe [1998’s] ‘Formulas Fatal To The Flesh’, which ‘Formulas’, Trey [Azagthoth, guitar] wrote all the music, all the lyrics and things like that. But this was done more similar to maybe [2000’s] ‘Gateways To Annihilation’, where everybody had their contribution. Trey wrote a bunch of songs, I wrote songs, Scotty contributed some ideas. There was a lot of back-and-forth. In the end, it has to become a MORBID ANGEL song. And at this point, I feel that it’s very much a MORBID ANGEL album.”

MORBID ANGEL in January announced the addition of Dan Vadim Von (guitarist/frontman of the American death metal band VADIMVON) to the band’s lineup on second guitar. He joined the group as the replacement for Norwegian guitarist Destructhor (a.k.a. Thor Anders Myhren), who left the band two years ago.

Former MORBID ANGEL frontman David Vincent recently joined forces with several other musicians — including Yeung (drums) — to perform classic MORBID ANGEL songs under the I AM MORBID banner.

MORBID ANGEL’s avant-garde metal masterpiece 2011 album, “Illud Divinum Insanus”, marked the group’s first CD to feature Vincent since “Domination”.

 

The reason Morbid Angel is featured in these pages is because Morbid Angel is 30 years of the World’s Greatest Heavy Metal of all-time and one of the GREATEST HEAVY METAL BANDS OF ALL-TIME. Acutally the Morbid Angel album “Domination” is ranked/ rated as one of the GREATEST TRADITIONAL HEAVY METAL ALBUMS OF ALL-TIME, by hundreds of KICK ASS METAL staffers, but as the Boss, I have the Knowledge to Know that Crest of Darkness “The Ogress” is the greatest heavy metal album of all-time, which has been a undisputed fact @ KICK ASS METAL since it was unleashed upon Planet Metal, back in May 12th, 1999, KICK ASS METAL is a GOTHIC age/ Avant-Garde age/ Death Metal age publication and Crest of Darkness has all 3 of those factors to perfection…..so that is the objective/subjective aspect of that fact. Morbid Angel as a traditional heavy metal band, as well as a death metal band has 6 albums in the top 100 heavy metal albums of all-time, in the traditional metal realm, those album are Abominations of Desolation 1986/19991 — Altars of Madness — Blessed are the Sick — Covenant —- Domination and —- Entangled in Chaos, as a traditional metal and extreme metal fan, all of those 6 albums also belong on the top 100 extreme metal albums of all-time, also. As a Avant-Garde Age Publication, the Avant-Garde Metal Community championed the Avant-Garde Metal Timeless Masterpiece “Illud Divimum Insanus”….which that article has now been pulled but I have a photographic memory so I remember that article being published, because I have a print out of it as I went to the record store for that album, since it achieved the status of being, SUPREME IMMORATAL METALLIC ART OF THE HIGHEST ORDER FROM THE GOTHIC METAL/ AVANT-GARDE METAL COMMUNITY !!!! I have been going to the record store 3 to 4 times a week since October 1st, 1982, when I lived 3 blocks away, 900 feet awasy from a METAL ELITIST / METAL ONLY record shoppe !!!!!
Morbid Angel is one of the few artist from the GOLDEN AGE OF HEAVY METAL. AUGUST 1ST, 1981 TO OCTOBER 31ST, 1986, to be covered in these pages. Motörhead, Morbid Angel are two bands that never sold-out or washed-up and washed-out like every 1980’s heavy metal bands. 1980’s heavy metal artist could not cut it in the 1990’s…first wash-ups and sell-outs in 1985 and the genre being THE LAUGHING STOCK OF heavy metal community, skateboards and Bermuda shorts…etc….!!!  That is the reason the Death Metal age happened and is still the zeitgeist of the genre. And the Genre got a crushing blow When Metallica unleashed upon Planet GLAM METAL the timeless AOR/GLAM Metal masterpiece Metallica “Metallica” on August 12, 1991 the Mötley Crüe-esque Metallica “Metallica” even getting Mötley Crüe’s producer to achieve the AOR/Glam Metal/ Hair Metal/ Los Angels Metal sound and style…..As a Glam Metal fan I claim Metallica “Metallica” as one of our own….and appears on the top 100 GLAM METAL ALBUMS OF ALL-TIME LIST, and is a KICK ASS METAL HEAVY METAL HALL OF FAME album in the GLAM METAL category. Most of the sell-out thrash metal albums are perfect for a GLAM METAL RECORD COLLECTION — Metallica “Metallica”, Megadeath “Countdown to Extinction” Testament “Practice What Your Preach”. As a gothic metal age publication there is no such thing as selling out in OUR genre, but Heavy Metal is the only genre where this phenomena/ selling out occurs….and seeing Metal bands sellout is not only fascinating, put kind of cool really seeing Metal bands cater to the people who hated them since day one, while betraying the fanbase who made them millions and legends in the first place. As a gothic metal fan, I know the difference between hard rock and heavy metal and gothic metal, and it is cool to watch almost every song-writer from the 1980’s to be fascinated with the Popular Culture song-writing formula. It still listen to Classical Music and Heavy Metal/ Gothic Metal 50/50. It helps keeps me geared toward the gothic/avant-garde side of heavy metal!! Keep in Mind Thrash Metal was already dead, wash-up, and sold-out long before Metallica released a album Metallica “Metallica” on August 12th, 1991…. which has more in common with Pantera’s “Power Metal” Mötley Crüe “Too Fast for Love”, Mötley Crüe “Shout at the Devil” and WASP “WASP” instead of Tyges of Pan Tang “WildCat”. Were just letting you know the actual subjective/objective facts as why Metallica was a KILLER METAL band for just say 5 years and Morbid Angel achieved 30 years of the greatest heavy metal band of all-time !!!

 

Morbid Angel

Select Discography

 

 

Abominations of Desolation  * 1986/ 1991  

TOP 100 TRADTIONAL HEAVY METAL ALBUM OF ALL-TIME

TOP 100 DEATH METAL AGE ALBUMS OF ALL-TIME

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

 

Altars of Madness * 1989

TOP 100 TRADTIONAL HEAVY METAL ALBUM OF ALL-TIME

TOP 100 DEATH METAL AGE ALBUM OF ALL-TIME

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

 

Blessed Are The Sick * 1991

TOP 100 TRADTIONAL HEAVY METAL ALBUM OF ALL-TIME

TOP 100 DEATH METAL AGE ALBUM OF ALL-TIME

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

 

Covenant * 1993

TOP 100 TRADTIONAL HEAVY METAL ALBUM OF ALL-TIME

TOP 100 DEATH METAL AGE ALBUM OF ALL-TIME

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

 

Domination * 1995

TOP 100 TRADTIONAL HEAYV METAL ALBUM OF ALL-TIME

TOP 100 DEATH METAL AGE ALBUM OF ALL-TIME

GREATEST TRADTIONAL HEAVY METAL ALBUM OF ALL-TIME

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

Formula’s Fatal to the Flesh * 1998

Gateways to Annihilation * 2000

Heretic * 2003

 

Illud Divinnum Insanus * 2011

AVANT GARDE METAL TIMELESS MASTERPIECE

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

 

 

Juvenila * 2015

Kingdoms Disdained * 2017

TOP 100 HEAVY METAL ALBUMS OF 2017

 

 

 

Cradle of Filth

(Ipswich, United Kingdom)

WORLD’S GREATEST HEAVY METAL BAND OF ALL-TIME #1 RANKING — INTERNATIONAL — SINCE FEBRUARY 24TH, 1994

Cradle of Filth has 21 RELEASES ON OUR TOP 100 ALL-TIME GREATEST RELEASES OF ALL-TIME IN THE GOLD STANDARD OF HEAVY METAL, NO ARTIST IN HEAVY METAL’S TOP-TIER OF THE UPPER ECHELON IN METALLIC MAYHEMIC HISTORY HAS EVER HAD 25% THERE RELEASES as part of THE GOLD STANDARD of heavy metal — IN 4 MORE ALBUMS CRADLE OF FILTH WILL ACHIEVE THIS FEAT   —- Cryptoriana—  The Seductiveness of Decay IS THE 12TH FULL LENGTH SPLATTER PLATTER Full length from Metal’s Greatest Extreme metal band of all-time 

….as a specialized press for True Norwegian GOTHIC Metal/ Avant-Garde Metal/ Dark Metal / Horror Metal there is a #1 ranking for a Norwegian National artist….

Cryptoriana—  The Seductiveness of Decay

TOP 10 HEAVY METAL ALBUM OF 2017

TOP 100 HEAVY METAL ALBUMS OF THE 21ST CENTURY

TOP 100 HEAVY METAL ALBUMS OF ALL-TME

Unleashed on Planet Metal

September 22nd, 2017

NUCLEAR BLAST GmbH RECORDS / Radiation

NB 3805-2/ 27361 38052

 

THE METAL GODS AND METAL LEGENDS AND IMMORTALS OF METAL ON THIS TIMELESS MASTERPIECE ARE

Dani Filth * Vocals

Lindsay Schoolcraft * Keyboards and Vocalist

Rich Shaw * Guitars

Ashok * Guitars

Daniel Firth * Bass

Marthus * Drums

 

Liv Kristine  * Guest Vocalist on “Vengeful Spirit

 

 

THE SONGS YOU LOVE AND KNOW BY HEART AND FOREVER BURNED ON TO YOUR DNA ARE

 

Exquisite Torment Awaits

Heartbreak and Seance

Achingly Beautiful

Wester Vespertine

The Seductiveness of Decay

Vengeful Spirit

You Will Know the Lion By His Claws

———-Digipack bonus tracks————

The Night at Catafalque Manor

Alison Hell

 

 

The year is 1994 and the boss of the publication that I worked for previous to this one, walks in the offices and takes down from the offices heavy metal hall of fame, the greatest album of all-time at the time which was Deicide’s “Deicide” since this was the beginning of the Death Metal AGE, as all the thrash bands, minus a half a dozen were all washed up and all about to sell out, on or around August 12th, 1991, all the thrash clubs were about to close down. The boss takes down the Deicide Press Photo and Deicide “Deicide” album, and puts up the Cradle of Filth “The Principle of Evil Made Flesh” and points to me, since I always compiled top 100 heavy metal albums list, and say to me “World’s Greatest Heavy Metal Band” and “World’s Greatest Heavy Metal Album”

That was 22 years ago !!!!!!!! …….. And our offices has 22 stacks of the 21 Cradle of Filth FUCKING ESSENTIAL Cradle of Filth releases !!! I have a second job always to make sure this done with in a calendar year, because as soon as January of each year comes I recollect the top 100 heavy metal albums of the golden age of heavy metal August 1st, 1981 to October 31st, 1986 as well as the top 100 heavy metal albums of the death metal age 1990 —present. So yesterday the new Cradle of Filth “Cryptoriana —The Seductiveness of Decay” was Unleashed on Planet Metal…..I bought 2 copies of this on digipack yesterday…!!!! And I was really excited, and of course this is a contender for album of the year alongside Infernäl Mäjesty “No God”

And the GODLY Major Ragers Torture Squad who hail from São Paulo, Brazil

So the album of the year publish the first list by October 30th of each year so you know what CD’s to pass out for Halloween, since every day is always Halloween @ every GOTHIC and GOTHIC METAL publication world-wide !!! I am starting to take pride in the fact I have survived publications such as Ill-literature, Industrialized Metal Webzine, Goth Metal World, and Avant Garde Metal…..!!!! If your a fan of the social network Vampire Freaks, then we hope we live up to our potential, of being the successors to Goth Metal World !!!!!!!!!!! Celtic Frost “Into The Pandemonium” is the album which gave this webZine its direction, alongside Avant-Garde Metal and Ill-Literature webZines…..As a heavy metal fan since August 1st, 1978, there was no gothic metal until November 2nd, 1987 and of course there was only traditional metal and underground metal to listen too and innovation were only in small and safe increments..!! So Cradle of Filth “The Principle of Evil Made Flesh” was the godsend…..be the change in the world you want to see and be strange !!

GOTHIC METAL AND AVANT-GARDE Metal yeah MAKE IT….. we don say “Weird” we say KICK ASS…The two genres HAVE the same birthday from the same progenitor release

http://www.avantgarde-metal.com

 

 

I was already listenting to Celtic Frost “Into The Pandemonium” and Sabbat’s “History of a Time to Come” on a daily basis. Since I always love the more KICK ASS METAL RELEASES in heavy metal

 

 

As a Annihilator fan since day 1 with the first demos….!!!! I love the digipack version of this album, because one of the two bonus tracks is

Annihilator “Alison Hell”

Cradle of Filth’s “Cryptoriana — The Seductiveness of Decay” is the 2nd full length Lindsay Schoolcraft has been on as the metal legends and metal gods keyboard player and backing vocalist….and while I worship hard every era of Cradle of Filth…the last 2 albums she has been on are total KICK ASS METAL ALL THE WAY…and is in the fucking essential realm when talking about SUPREME IMMORTAL METAL ART OF THE HIGHEST ORDER !!!!! …aka the KICK ASS METAL stuff ie, the true metal, the actual metal !!!!! !!!! But as the ONLY METAL PUBLICATION that specializes in KEYBOARD-centic heavy metal or heavy metal featuring the best of the best bands with the WORLD’S GREATEST KEYBOARD players….!!!!! You know the future this page will be stamped with all-things Lindsay Schoolcraft !!!!! Because while all day every-day is Halloween, i will still add to my collection the greatest albums of all-time no matter the genre, especially avant-garde, classical, avant-garde classical, gothic, gothic metal and all things bad ass and kick ass !!!!!!!!!!!!!!!!!!!!!!!!!!

 

 

It should be obvious to the oblivious that 2 of my major influences

Metal MaidenS

http://www.metalmaidens.com

and

Sonic Cathdral

http://www.soniccathedral.com

 

Are stamped all-over this page !!!!!!!!!!!!!!!!!!!!!!!

 

 

 

You can trust ONLY YOUR SELF, THE FIRST 6 BLACK SABBATH ALBUMS, (i also have a few choice ones, after this fact, the first 6) AND THE 21 CRADLE OF FILTH RELEASES THAT are Studio albums, live albums, compilations, DVDs.

 

And for those who disagree with our 22 years onslaught coverage of Cradle of Filth. Here is the world’s smallest violin ….!!!!!!!!!!!!!!!!!!!!!!!! Cry me a river of blood &  Play me a song FUCKERS !!!!!!!!!!!………………In 2024 i am psyched to feature the whole year of  2024…..CRADLE OF FILTH 30 YEARS OF THE WORLDS GREATEST HEAVY METAL BAND OF ALL-TIME !!!!!!!!!!!!!!!!!!!!!!!! For those who are thinking what if they “Sell-Out” well i will catch you up to speed….cause your slowwwwwww ….. the gothic culture does not have a “concept” of bands “selling out”. Posers in the true metal community invented that bullshit story with a million of holes I can poke fun of and mock, endless for a million hours at a time  !!!!!!

 

And I froth @ the mouth knowing I have bought every record collection of Cradle of Filth’s detractors……!!!!!!!!!!!!!!!!! And I enjoy that each of the of those assholes are now, soft rock fans, and worse …….!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

 

Earlier today, a KICK ASS MEAL fan wanting to finance me a book, asked how much I would need to write a book in the vein of the Gary Sharpe-Young book….I Said 2 Million dollars….because I only do thinks i right and real way !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! Metallic altars of heavy metal mayhem and heavy metal hall of fames are built around artist such as Cradle of Filth and “Cryptoriana — The Seductiveness of Decay” !!!!!!!!!!!!!!!!!!! With stunning artwork from Arthur Berzinsh, this album is a true “must have” and FUCKING ESSENTIAL ALBUM …………..BUY OR FUCKING DIE !!!!!!!!!!!!!!!!!!!!!

 

THRASH AND RAGE AND BANG YOUR HEAD UNTIL YOUR BRAIN L@@KS LIKE A BLOODY PANCAKE !!!!!!!!!!!!!!!!

BIRTH * LIFE * CRADLE OF FILTH * DEATH

BIRTH * LIFE * CRADLE OF FILTH * DEATH 

BIRTH * LIFE * CRADLE OF FILTH * DEATH 

BIRTH * LIFE * CRADLE OF FILTH * DEATH 

BIRTH * LIFE * CRADLE OF FILTH * DEATH 

 

Cradle of Filth Select Discography

Cradle of Filth SELECT DISCOGRAPHY all TOP 100 HEAVY METAL ALBUMS OF THE YEARS THEY WERE UNLEASHED ON PLANET METAL and ALL-ON OUR TOP 100 HEAVY METAL ALBUMS OF ALL-TIME LIST !!!

 

The Principle  of Evil Made Flesh February 24th, 1994

V Empire or Dark Faerytales in Phallustein *  April 22nd, 1996

Dusk and Her Embrace * August 18th, 1996

Cruelty and the Beast *April 27th, 1998

PanDaemonAeon * July 27th, 1999

From the Cradle to Enslave  * November 2nd, 1999 — Music For NationS Pressing

From the Cradle to Enslave * December 14th, 1999 — Metal Blade Records Pressing

Midian *October 30th, 2000

Bitter Suites to Succubi *June 18th, 2001

Heavy Left-Handed and Candid * November 25th, 2001

Lovecraft & Witch Hearts *May 13th, 2002

Live Bait for the Dead * August 19th, 2002

Damnation and a Day * March 10th, 2003

Nymphetamine * September 27th, 2004

Peace Through Superior Firepower * November 22nd, 2005

Thornography *October 16th, 2006

Eleven Burial Masses *May 5th, 2007

Godspeed on the Devil’s Thunder * October 20th, 2008

Darkly, Darkly Venus  Aversa * November 1st, 2010

Evermore Darkly * October 17th, 2011

Midnight in the Labyrinth *April 21st, 2012

The Manticore and Other Horrors * October 30th, 2012

Hammer of the Witches * July 10th, 2015

Dusk… and Her Embrace – The Original Sin *July 8th, 2016

Cryptoriana – The Seductiveness of Decay *  September 22nd, 2017