Archives for posts with tag: Nervosa thrash

nervosa_rulestheplanetmetal4ever

kick_ass_metal_RULES-NERVOSA_RULES_1531855_415181481969274_188441262536555540_n

One February 28th, 2014 The 34th Greatest Heavy Metal Debut album of all-time, in chronological order was UNLEASHED ON PLANET METAL. Debut album winners from 1980 until 2014 is 34 World-Class Heavy Metal artist. This was 1 year and 9 months ago. Since Nervosa “Victim of Yourself” is also the 2014 Heavy Metal album of the year in HEAVY METAL. We are celebrating this feat in METALLIC HISTORY, on every 28th of EVERY MONTH the offices of KICK*ASS*METAL celebrates our # 1 THRASH METAL album of the 21st Century. Nervosa Not only Made KICK*ASS*METAL’s top 100 albums of all-time in Extreme Metal, they are the ONLY 21st century heavy metal band who made our 1980’s RIFF LORD top 100 Traditional Metal albums of all-time Heavy Metal Hall of Fame, list

1535713_240390959498371_139153524042756780_n

nervosa-kam_file_10157387_625279000853881_591689557_n

nervosa_kam_file_10392385_737842639597516_3258138959404015266_n

Nervosa

Victim of Yourself

Naplam Records

100 out of 100 blood dripping skulls

Napalm Records

NPR 520

EAN UPC 8 19224 01732 5

The IMMORTALS OF METAL on this TIMELESS MASTERPIECE ARE

Fernanda Lira * World Class Vocalist / World Class Bassist

nervosa_kam_file_1399524_568616599853455_451396667_o

Prika Amaral * World Class Guitarist and World Class Background Vocalist

prika amaral_98765432_568253883223060_1130738908_kam

Pitchu Ferraz * World Class Drummer

kick_ass_metalpitchu_ferraz_2013_98765432_680116332036814_4185722326752429415_kam

Track listing *** aka *** THE SONGS YOU LOVE AND KNOW BY HEART ARE

Intro

Twisted Values

Justice Be Done

Wake up And Fight

Nasty Injury

Envious

Morbid Courage

Death!

Into Moshpit

Deep Misery

Victim of Yourself

Urano Em Nos

TWISTED VALUES

Written by : Fernanda Lira, Prika Amaral * Lyrics by : Fernanda Lira

Disorganized State, organized crime
Fear is taking over, hate being spread
fight for equality, so there’s no excuses
Not a society’s product, but their own choice’s

A Covered Up Civil War
Laws Done By Outlaws
Lives taken in vain
Terror practiced for fun

Twisted Values
Impurity
Twisted Values
Injustice

No role modles to follow, no enough laws to punish
Being evil is good, violence is usual

Killings going on and nothings done
Don’t do it by need, it’s pleasure (casuse) they’ll be free

Until when lives will be valueless?
Until when we’ll sustain them?
Until when we’ll be victim’s of their responsibilities?

Twisted Values
Impurity
Twisted Values
Corruption

JUSTICE BE DONE

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Children defenseless against cowards
Torture, abuse, harm
Leave Marks, satisfy desires
Evil pest, what is going on?

Fear
of the filthy hands
Guilt
of doing nothing
Pain
suffering in silence
Rage
they just can’t forget

Justice be Done
Silent Hurt
Justice be Done

Nowhere to run or to hide
No enough laws to punish or fight
The family won’t listen their cry
I speak in the name of this child

WAKE UP AND FIGHT
Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Wake up and fight!
Wake up and fight!

While you’re hungry-they feed their greed
While you’re homeless-they live confomfortably
While you’re dumb-they steal your money
When you’re blingd-they make fake promises

Own benefit
Death of Ethic
Power Games
Laughing at ya

The raise up the flag of fucking likes
They betray us who should be (their) allies
Submit us to their shitty corruption

People don’t know
Were on Control!

NASTY INJURY

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Prika Amaral

Time becoming a loss
Transforming every minute in pain
Won’t escape, took the blame, cold blood
Searching the unthinkable

Want to make otherwise
A moment of pure ambition
Seeking a reversal mode
You won’t get nothing from revenge

Search will be constant
Return won’t exist
Time Will be lost
No Satisfaction

Revenge!
Suffering!
Are the Consequences of his revenge
Revenge!
Suffering!
Are the principle of his defeat now
Revenge!
Suffering!
Are the values of your life now

ENVIOUS

Written by: Prika Amaral, Fernanda Lira and Fernanda Terra Lyrics by: Fernanda Lira
Watch other thrive
Corrodes you inside
Wasted Struggle
Insult to your self-worth

You envy but you don’t recognize the hard work
My wise piece of mind-your frustration inside

Shut, move,
No words, but action
Shut, move
Pursuit satisfaction

It made me stronger
I forgave the slander
Incompetence, hate
Makes you feel this way

Trust your value
Do it better
Don’t envy other
Have your merits

MORBID COURAGE

Written by: Prika Amaral, Fernanda Lira and Fernanda Terra Lyrics by: Prika Amaral

A loser
A weak
A coward
Not able to build

Your life a mistake
Stealing won’t change you better

Inability, agony will go over you
Coward character
The hate, disgrace is what you’re gonna get

Your not free – and will never will be
Your not free – mistaken obsession

Morbid courage
Morbid and lost

Freed is lost
You choose the evil path

Your life – disgrace
You’ll pay for what you caused

DEATH!

Written by: Prika Amaral, Fernada Lira Lyrics by: Prika Amaral

The line is formed, wait for your turn, it’s going to come
Your are not alone and not going to die alone
There is a wall of people like you, afraid and crying, begging for life
Memories from your past, despair in your mind, the time has come

Bullet in the skin
Bullet in the head

Draining blood
Aiming The target
The end, the execution

Death! Death! Death!
Death! Death! Death! Shots fired

What was your sin? Why are you there? Do you deserve it?
Is if fair? Is it right? Is it wrong? What is justice?
Is it a education matter? Is it a religion matter?
Is it a culture matter?
What is going on?

INTO MOSHPIT

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Join the army, get in the violent mosh
Metal taking over
Arise your fistful of metal
Join the art of partying
Don’t care (about) the morning after

Bangers are bonded by blood
So the legacy survive
There’s no space for ignorance
There’s no malicious intent

No illusions
Grin on face
Show no mercy
This is thrash zone

The most terror squad
Is possessed by fire
Extreme aggression
Metal pandemonium

Into moshpit
Into moshpit
Into moshpit
Into moshpit

DEEP MISERY

Hunger compresses the stomach, despair increasing
Skin and bones, weakness, anemia and diseases

The cold from the ground freezes the sould
People despise deep misery
Who cares, does nothing change
Tis is no impossible for anyone

Anybody cares?
Anybody care?

The pain not to be nothing
the pain not to ben anyone anyone
The pain not to be anymore
The pain to be exclude

Deep misery
Deep misery
Deep misery
Deep misery

The pain of hunger is not a reason
People pretend not to see
Who care, dones not contribute
Any you can be in this situation

Repeat chorus

A bother of a hard ground bring pain
People ignore what they see
Who cares, doesn’t really help others
This can not happen to you, you are not free

Anybody cares?
Anybody cares?

VICTIM OF YOURSELF
Lyrics by: Fernanda Lira

The real you isn’t what you show
Your Not authentic
Blame others for your flaws
It is easier than admitting them

A lack inside, hidden by pride
Victim’s the hurt child lying inside

CHORUS

Victim of
Victim of yourself
Victim of
Victim of yourself

It is the only way to get your need’s satisfaction
It is the only way you’ll get attention
It is the only way you’ll deserve compassion
It is the only way you can fell you’re special

REPEAT CHORUS

You think you’re always right
Never Swallow your pride
Don’t admit your wrong
Hurt the ones who love you

REPEAT CHORUS

Created a safe, lunatic world to run from yourself
Afraid, you know you’ll be alone when truth overcome this lies

(Your) freak attitudes will come back to you
Don’t say you got nothing to do with the disgrace

REPEAT CHORUS

It is the only way (you) play the kid forever
It is the only way you won’t admit your shallow
But beware you’re creating your own prison
You’ll only become crazy, faker and alone

REPEAT CHORUS

URANIO EM NOS
Lyrics: By Prika Amaral

Condenados a morte
Condenados ao cancer
Devstaco atomica
Invadindo o nosso sangue

Uranio em nos
Uranio em nos
Uranio em nos

Uranio em nos
Uranio em nos
Uranio em nos

Fukushima
Chernobil
Tokaimura

Uranio em nos
Uranio em nos
Uranio em nos

Uranio em nos
Uranio em nos
Uranio em nos

Fukushima
Chernobil
Tokaimura

After a short intro entitled Intro and it starts of with LOUD cracking of thunder lighting and a creaking gate, and machine gun fire, and has a totally ominous vibe, that every fan of metal should be able to enjoy and notice the screams in the background, and the RIFF @ the 56 second mark displays why Prika Amaral is KICK*ASS*METALS favorite guitar player who was voted # 20 world-wide of all time, as the greatest guitarist in not only traditional metal but true metal, what later became known as extreme metal. This piece of music from 56 – 2:00 minutes mark is totally mind-blowing and jaw dropping, and a sight to behold.

Twisted Values is up first and this song is a perfect example why Prika Amaral is a top 20 ranked / rated Guitarist of all time With KICK*ASS*METAL and it subsidiary the KICK*ASS*METAL heavy metal hall of fame.

Prika Starts the proceeding with one of the most unique guitar tones I have heard in a longtime.

And a 54 second in Nervosa demonstrates why they are one of the most original and most important bands of the decade of 2010 and of all time.

By 229 Prika Amaral executes a rather awesome guitar solo.

Justice Be Done starts of with a rather unique riff and the song builds up nicely then around the 33 second mark the Nervosa trade mark sound is in full effect. Around the 108 mark excellent vocals provide by BOTH Fernanda Lira, and Prika Amaral. The solo @ the 140 mark will have your jaw on the floor and ends around the 2 minute mark. Fernada Lira sounds unreal on this one, make Fernada Lira the most magnificent most original metal vocalist of the decade 2010 and of all time

Wake Up and Fight is up next by the tome of 1 minute in the Prika Amaral guitar tone really gets to shine. Lots of genius to the songwriting on the music on this song at this point. Fernanada Lira really shines as a world-class vocalist on this song. The solo at the 245 mark is rather breath-taking and will send chills up and down your spine. This song is a total metal CRUNCHER.

Nasty Injury starts off with the one-of-kind guitar tone of Prika Amaral and around the 40 second mark Nervosa gets into high Nervosa thrash gear before the two-minute mark Prika Amaral does some excellent riff work then around the 2:10 mark some excellent riff and rhythm work is excecuted by Prika Amaral. The solo @ the 2:20 – 2:27 mark is totally well written and executed by World Class Guitarist Prika Amaral. And the rhythm section work by Fernanda Lira and Pitch Ferraz is totally mind blowning a perfect in all songwriting aspect. The songs main riff is used throughout the 3 minutes mark

Envious is up next. The Solo at the 2:14 mark is executed very well and demonstrates why Prika Amaral is a top rated in the top 20 of all time at kick ass metal. And Fernada Lira does some world-class bass work @ the 2:20 mark. Then @ the 2:26 mark Prika Amaral writes one of the most head banging riffs of the 21st century. The guitar tone of Prika Amaral that I love the most is on display @ the 2:40 mark. The song picks up pace then @ the 3:40 mark the song down shift into bone cruching metal style, the kind of songwriting that is perfect for head banging.

Morbid Courage is up next, and starts of Prika Amaral’s signature one-of-a-kind guitar tone. And has an excellent song build up in terms of intensity and heaviness in the fist minutes. Morbid Courage has excellent Lira/ Amaral vocal exchanges in the 1 and a half-minute mark. There is a perfect example of Pitchu Ferraz world clas drumming style @ the 1:50-1:58 mark. @ the 1:58 mark the song downs shifts for an excellent Prika Amaral solo, @ the 2:05 second mark.

Death! is up next and is one of the Greatest, written Metallic songs of all time. Prika Amaral displays every aspect of her unique and original style. I have watched the legendary video for over 7, 899 times by now since it was released around a month ago. The guitar solo starts @ the 1:22 mark and is well written and executed perfectly by metal axepert Prika Amaral. And last to the 1:54 mark. @ the 2 minute mark, the song is totally in the pocket, At the 3;00 minutes mark the Prika Amaral one-of-a-kind guitar tone is one display again in all its metallic glory.

THE GUITAR SOLO on DEATH! is one of KICK*ASS*METAL’S personal favorites of all time. Our jaws were on the floor on this one. 100% world-class dedication to her instrument.

Into Moshpit is up next and @ the 40 second mark, once can hear a totally unique and original riff executed by Prika Amaral. The guitar work provide by Prika Amaral in the 1st minute of this song can only be called original and world-class, and is provides total Nervosa thrash metal evocation. @ the 1:07 mark there is a totally KICK*ASS*METAL riff written and executed by Prika Amaral, it is because of guitar work like this, that Prika Amaral will forever be remembered as the most important, original, and magnificent guitarist of the 21st Century. Nervosa is not retro-this or retro-that, but a band that will survive the test of time. I am totally addicted to this song, because of Prika Amaral awesome guitar tones. The solo is @ the 3:14 mark, and is pretty mind-blowing and pretty stellar and world-class

Vicitm of Yourself is up next. And starts of with a totally original riff a PRIKA AMARAL riff, you can tell in a micro-second who Prika Amaral is over the other 92, 999 guitarist who also play metal. What one notices immediately about Prika Amaral is that Prika is a one-of-a-kind and a true original. @ The 48 second mark a killer song writing part takes place. Victim of Yourself the song, has one of the greatest riffs not just of the decade 2010, but of all time.

Uranio Em Nos…aka via translation means something similar to “Uranium in” * And this song starts with an AIR RAID siren. And that is just songwriting genius. The CD’s closer has a lot of excellent metal vibes because it is sung in Nervosa native language giving the song a nice personalized aspect from the songwriters point of view. World Class job on this song and the whole album.

I love Nervosa

and

I am a NERVOSA-thrasher 4 life !!!!!!

The total time for the debut album of the year 2014 is

45 minutes and 41 seconds

Japanese Pressing of Nervosa “Victim of Yourself” released March*19*2014
kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

NERVOSA (GODS)

VICTIM OF YOURSELF

NAPALM RECORDS

100 out of 100 blood dripping skulls

FEB 28, 2014

KICK*ASS*METAL DEBUT ALBUM OF THE YEAR 2014

SINCE NERVOSA is the 34th Band in 1980′s / 1990′s metal band, to be the WINNER OF THE DEBUT ALBUM OF THE YEAR 2014. Here is the list of the best of the best !!!
Best debut albums

WORLD’S GREATEST DEBUT ALBUMS IN HEAVY METAL 1980-2014

2014 * Nervosa * VICTIM OF YOURSELF

2013 Latern * Below

2012 Abnormality * Contaminating the Mind Hive

2011 The Konsortium * The Konsortium

2010 Triypkon * Eparistera Daimones

2009 FEN* The Malediction Fields

2008 Hail of Bullets…of Frost and Blood

2007 Slavia * Strength and Vision

2006 Iperyt * Totalitarian Love Pulse

2005 Crucified Barbara * In Distortion we trust

2004 The Amenta * Occasus

2003 Disiplin (NORWAY) * Disiplin

2002 Bloodbath * Resurrection Through Carnage

2001 Dragonlord * Rapture

2000 Hypnosia * Extreme Hatred

1999 The Kovenant * Animatronic

1998 Ritual Carnage * The Highest Law

1997 Nocturnal Breed * Agressor

1996 Impiety * Asateerul Awaleen

1995 Usurper * Diabolosis

1994 Cradle of Filth * The Principle of Evil Made Flesh

1993 Necrophobic * The Nocturnal Silence

1992 Incantation * Onward to Gologatha

1991 Dismember * Like A Ever Flowing Stream

1990 Deicide * Deicide

1989 Morbid Angel* Altars of Madness

1988 Sabbat * History of A Time To Come

1987 Death * Scream Bloody Gore

1986 Exumer * Possessed By Fire

1985 Exodus * Bonded By Blood

1984 Bathory * Bathory

1983 Slayer * Show No Mercy

1982 Tank * Filth Hounds of Hades

1981 Venom * Welcome To Hell

1980 Tygers of Pan Tang * Wildcat

TOP 100 TRADITIONAL METAL ALBUMS OF ALL-TIME

Abattoir- Vicious Attack
Accept- Restless and Wild
Acid- Acid
ACID * MANIAC
ACID LIVE IN BELGIUM ’84
Agent Steel- Skeptics Apocalypse
Agent Steel * Mad Locust Rising
Anacrusis- Screams and Whispers.
ANGEL DUST- INTO THE DARK PAST
Angel Witch * Angel Witch
ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland
ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS
Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…
Anvil- Metal on Metal
ANVIL- FORGED IN FIRE
Anvil- Live in concert
Anvil-Worth the weight
ANVIL CHORUS * THOUGHT CRIMES
Anvil Chorus * The Killing Sun
Artillery * Fear Of Tomorrow
ARTILLERY * TERROR SQUAD
ARTILLERY * By Inheritance
ATHEIST- PIECE OF TIME
ATHEIST- UNQUESTIONABLE PRESENCE
Attacker-Battle at Helms Deep
Attacker-Second Coming

BATHROY * BATHORY
Bathory * The Return…
Bitch * Damnation Alley
Bitch- Be My Slave
Black Death * Black Death * Auburn Records
Black Sabbath- Mob Rules
BLIND ILLUSION- THE SANE ASYLUM
Bloodlust – Guilty As Sin
BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS
BLITZKRIEG * A TIME OF CHANGES
Bulldozer * The Day of Wrath
Bulldozer * the Final Seperation
Bulldozer * IX

CACOPHONY- SPEED METAL SYMPHONY
Cage- Astromy
Candlemass-Nightfall
Carnivore * Carnivore
Cathedral- Supernatural Birth Machine
CELTIC FROST- MORBID TALES
Celtic Frost- Emperors Return
Celtic Frost- To Mega therion
CELTIC FROST- INTO THE PANDEMONIUM
Chastain * Mystery of Illusion
Chastain * Ruler of the Wasteland
Chastain * The 7th of Never
Chastain * The Voice of Cult
Chastain- For those who Dare
CHASTAIN- IN A OUTRAGE
CORONER * RIP

CORONER * PUNISHMENT FOR DECADANCE
COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE
COVEN * Worship New Gods…Coven …aka Coven13
CIRITH UNGOL * FROST AND FIRE
CIRITH UNGOL * KING OF THE DEAD
Crimson Glory- Crimson Glory
CRYPTIC SLAUGHTER * CONVICTED
Culprit- Guilty As Charged
CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld
Dark Angel * We Have Arrived
DARK ANGEL * DARKNESS DESCENDS
DARK ANGEL * LEAVE SCARS
DEF DEALER * KEEPER OF THE FLAME
DEF DEALER * JOURNEY INTO FEAR
DEATH- SCREAM BLOODY GORE
DEATH * LEPORSY
DEATH- SPIRITUAL HEALING

DEATH- HUMAN
DEATH-INDIVIDUAL THOUGH PATTERNS
DEATH * Symbolic
Death Angel- The Ultra-Violence
DEATH ANGEL- ACT III
Death Strike-Fuckin’ Death
Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe
Ded Engine * Hot Shot
Ded Engine * Hold A Grudge
Deep Switch- Nine inches of God
DESTRUCTION- INFERNAL OVERKILL
Diamond Head * Diamond Head…1980 …aka Lightning to the Nations
Diamond Head- Lightning to the Nations
Diamond Head- Behold the Beginning
Discharge * Hear Nothing, See Nothing, Say Nothing
Dream Death- Journey Into Mystery
DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC
Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS
ECXICER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS
Exhorder- Slaughter in the Vatican
EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE
EXODUS- BONDED BY BLOOD
EXODUS- PLEASURES OF THE FLESH
EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)
EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)
Exorcist * Nightmare Theatre
EXUMER * POSSESSED BY FIRE

FATES WARNING * NIGHT ON BROKEN
Fear of God * Within The Veil
FORBIDDEN- FORBIDDEN EVIL
FORBIDDEDN * TWISTED INTO FORM

Girlschool * Hit and Run

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS
GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS
THE GREAT KAT- WORSHIP ME OR DIE!
THE GREAT KAT- BEETHOVEN ON SPEED
THE GREAT KAT- BEETHOVEN SHREDS
Griffin- Flight of the Griffin

Hawaii- One Nation Underground
HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK
HALLOWEEN- DON’T METAL WITH EVIL
Hell- Hell (1982)…Demos come with 2 disc version of 2011 CD
H-Bomb- Attaque
HEATHEN- BREAKING THE SILENCE
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now

Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller

Killer * Wall of Sound
Killer- Shock Waves
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
Massacre- From Beyond
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE

MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- NO LIFE TIL LEATHER
METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview
METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end
METALLICA* LIVE * METAL UP YOUR ASS..1983 DEMO CASSETTE
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Metallica- Creeping Death/ Jump in the Fire CD
Metallica- Master of Puppets
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron

Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE

NERVOSA (BRAZIL) *TIME OF DEATH

NERVOSA (BRAZIL) *VICTIM OF YOURSELF

Nightmare * Astral Deliverance
NME * UNHOLY DEATH

OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilvon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power
RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swalled in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO

SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
Saxon * Denim and Leather

Scorpions- Taken By Force
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy

THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS
THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
The Rods* Wild Dogs
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error

Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
Warlord-Deliver Us
Warlord * And The Cannons Of Desturuction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
Whiplash * Power & Pain
Whiplash * Ticket to Mayhem
Wildestarr * Arrival
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

TOP 100 albums of all time NERVOSA “VICTIM OF YOURSELF”

Abnormality * Contaminating The Hive Mind * 2012
Acheron * Rites of The Black Mass
Annihilator * Alice in Hell
Assassin * The Upcoming Terror
Bathory * Blood Fire Death
Bathory * Under the Sign of the Black Mark
Bestial Warlust * Blood and Valour
Bloodreaping * Ignis Penumbra
Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!
Centuions Ghost * A Sign of Things To Come
Coroner * RIP
Cradle of Filth * The Principle of Evil Made Flesh
Crest of Darkness* Sinister Scenerio
Crest of Darkness* The Ogress
Crest of Darkness * Project Regeneration
Crest of Darkness * Evil Knows Evil
Crest of Darkness* Give Us Power To Do Your Evil
Crest of Darkness* In The Presence of Death
Crown of Thorns (Sweden) * Eternal Death
Dark Angel * Darkness Descends
Death * Scream Bloody Gore
Death Angel * The Ultra- Violence
Destruction * Infernal Overkill
Deicide * Deicide
Disiplin (NORWAY) * Anti-Life
Dismember * Like a Every Flowing Stream
Entomed * Left Hand Path
Exodus * Bonded By Blood
Exumer * Possessed By Fire
Exumer * Rising By The Sea
Fleshcrawl * Bloodred Massacre
Gravehill * Rites of the Pentagram * 2009
Hellcannon * Infected With Violence
Impiety * Skullfucking Armeggedon
Impiety Koas Kommand 696
Internal Bleeding * Vocarcious Contempt
Iperyt * Totalitarian Love Pulse * 2007
Killaman * Killman
Kings Evil * Deletion of Humanoise
Kreator * Pleasue TO Kill
Krisiun * Black Force Domain
Leviathan * The Tenth Sublevel of Suicide
Massacra (FRANCE) * Final Holocaust
Massacre * From Beyond
Metallica * Kill em All
Metallica * Ride The Lightning
Morbid Angel * Altars of Madness
Mythos * Pain Amplifier
Nercodeath * Into the Macabre
Necromessiah * Antiklerikal Terroristik Deathsquad
Nervosa (Brazil) * Victim of Yourself * 2014

Nightside * The End of Christianity
Nile * Amongst The Catacombs of Nephren Ka
Nocturnal Breed (NORWAY) * Agressor
Nocturnal Breed (NORWAY) * Fields of Rot
Nocturnus * The Key
Occult * Of Fleash and Blood
Occult * Elegy For The Weak
Pessimist * Blood For The Gods
Pestilence * Malleus Maleficarum
Possessed * Seven Churches
Onslaught * The Force
Rabelliun (BRAZIL) * Burn The Promise Land
Ritual Carnage * The Highest Law
Sabbat * (NIPPON) * Envenom
Sabbat * (NIPPON) * Envoke
Sabbat * (NIPPON) * Disembody
Sabbat * (NIPPON) *Fetishism
Sabbat * (NIPPON) *Karisma
Sabbat * (NIPPON) *Satanasword
Sabbat * (NIPPON) * Karmagmassacre
Sabbat * (NIPPON) * …And the Sabbatical Queen
Sabbat * (NIPPON) * To Praise the Sabbatical Queen
Sabbat * (NIPPON) *Sabbatrinity
Sabbat * (UNITED*KINGDOM) * History of a time to Come
Sadus * Swallowed in Black
Sepultura * Beneath The Remains
Slayer * Show No Mercy
Slayer * Haunting The Chapel
Slayer * Hell Awaits
Slayer * Live Undead
Slayer * Reign In Blood
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007
Surrender of Divinity * Oriental Hell Rhythmic
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Urgehal * Goatcraft Torment *
Warfect * Exoneration Denied * 2013
Walhalla * Firereich
Vader * The Ultimate Incantation
Vader * Litnay
Voi Vod * War and Pain
Zyklon (NORWAY) * Aeon

NERVOSA rakings at KICK*ASS*METAL ARE Worlds greatest thrash metal band of the 21st century NUMBER 1.

Our 34th annual debut album of the year winner 2014.

Top 20 Worlds greatest metal bands of all-time. Traditional and True metal.

Top 10 album of 2014, in over all category. This is what KICK*ASS*METAL knows over the other publications.

One day they will catch up to us.

NERVOSA are KICK*ASS*METAL heavy metal hall of fame member since March 2012.

nervosarulesplanetmetal_97643494237415_n

 

10620265_734827623232351_3480152283717759195_o

10408520_734828329898947_1293490584048797938_n

1272397_734826616565785_361712918841447172_o

nervosaheavymetalhalloffameliveinheadbangingacitonmetaldays98578i5644prikaamaralkramerworldclassgutiartist985795756a123prikaamaraltop20heavymetalguitaristofall-time98956784423prikaamaralworldclassguitaristnervosaheavymetalhalloffame9859864prikamaralworldclassguitaristnervosafame9895846nervosathefourhorsemenoftheapocalypse21stcentury987657846746374436347756767prikamaralnervosamarch2012heavymetalhalloffamemember2012199999765733nervosakickassmetalhallofame2012976473nervosarulesplanetmetal_9978957969709258122606873_nnervosarulesprikarules999757554516262278_nnervosarulesplanetmetal_9857674235963160940_opitchuferraz_kickassmetal_nervosalegend_987987_9999nervosafernadanlira_9967306_nnervosa_allfemalethrashmetalband_brazil_97846876355745563nervosa_kam_file_nervosa_rules_1148950_531206796927769_2106085976_nnervosa_kam_file_1150286_619439738104474_2079333222_nnervosa_kam_file_1525388_619439784771136_2028130789_nnervosa_kam_file_48076_619439758104472_1259539460_nnervosa_kam_file_1465351_619439798104468_1374313443_nnervosa_kam_file__kam9_539232_619439734771141_1985217046_nkam_file_nervosa_1175474_619439841437797_561048333_nnervosa_kam_file_nervosa1982362_619439831437798_629108958_nnervosa-kam-file_prika_amaral-headbanging-action_482404_561190117262770_797360577_nnervosa_kam_file_illovenervosa_542222_533645260017256_1720890417_nnervosa_kam_file_1554531_654628311252283_389711595090418296_nNervosastudio_9768967878046067_nnervosa_brazil_978768956nervosarulesplanetmetal_97865371287268840_n

 

prikaamaraltop20heavymetalguitaristofall-time98956784423

Advertisements

prikamaralkickassmetalheavymetalhalloffamelegend987967867575464353442

Prika Amaral is a 3 time KICKASSMETAL Heavy Metal Guitar Player of the Year Winner. 2012, 2014, 2016 for those who are not up on thrash and up on heavy metal MUSIC. Having started with Heavy Metal this year or last year, since your new fans to the genre were going to get you caught up on the GENRE’S GOLD STANDARD it a noun it is defined as the best, most reliable UNDERSTAND WHAT TRUST AND RESPECT is right, and the most prestigious of it category.

In this case the subject matter is WORLD-CLASS HEAVY METAL, if your something alert it is stated in the upper left hand corner of this page…World-Class always over everyone’s head so it is a adjective it is a musician. album, concert that are the among the best in the WORLD on PLANET METAL!!!!!!!!!!!!!!

 

Now for the press who covers heavy metal, and unaware of it defintion, because the concept of the RIFF never sunk in to the loud rock music press…. Heavy Metal it is a noun and it is defined as KICKASS energetic and highly amplified…ALL KNOBS TO THE RIGHT….RIFF BASED music that has sharp and effective deadly RIFFS, with stunning lead guitar work with a intense Savage Factor. The most important to word’s in the KICKASSMETAL definition of HEAVY METAL is the word RIFFS and MUSIC

nervosatop100heavymetalalbumofalltime99987978989784a20116

nervosaheavymetallegendsmetalgods97685743242344786786786a312312313

 

fernandaliranervosaheavymetalhallofamemarch2012inducteemetalgod9789678564623411

Prika Amaral Guitarist of the Year Achievement’s in Heavy Metal, they are

2012

KICKASSMETAL HEAVY METAL GUITAR PLAYER OF THE YEAR

2012

HEAVY METAL EXTENDED PLAY OF THE YEAR

2012

RIFF OF THE YEAR WINNER

2012

HEAVY METAL VIDEO OF THE YEAR WINNER

2014

KICK ASS METAL HEAVY MEAL GUITAR PLAYER OF THE YEAR

2014

HEAVY METAL DEBUT ALBUM OF THE YEAR WINNER

2014

HEAVY METAL ALBUM OF THE YEAR WINNER

2014

RIFF OF THE YEAR WINNER

2014

HEAVY METAL VIDEO OF THE YEAR WINNER

2016

KICK ASS METAL HEAVY METAL GUITAR PLAY YEAR OF THE YEAR WINNER

2016

HEAVY METAL ALBUM OF THE YEAR WINNER

2016

RIFF OF THE YEAR WINNER

2016

HEAVY METAL VIDEO OF THE YEAR WINNER

NERVOSA AND PRIKA AMARL

RANKING THRASH METAL METAL 21ST CENTURY

# 1 WORLD-WIDE RANKING/ RATING

FOR THOSE WHO DO NOT UNDER THAT RANKING NUMBER. IT MEANS

NERVOSA IS THE GREATEST THRASH METAL BAND OF THIS. THE 21ST CENTURY

prikaamaralheavymetalheroguitargoddesslegend9897897897897897897898

Everyone was warned back, as early as 1984/1985 when i ranked Exodus and Slayer in the best top 10 Heavy Metal bands of all-time, at that time. You were told that this is a Exodus/Slayer-centric publication. And those who make they “claim” i over-rated those bands back in the early 1980’s, i just have to say to you.
YOU WERE NEVER INVITED to rank the top 100 albums bands of all-time in the first place, (from 1983 on –) several hundred of people got the invite to talk about this, you were not even considered.
Because if you were not a heavy metal fan, since May 1979 Starting with the beginning of NWOBHM or December 1983 when Slayer unleashed “Show No Mercy”.
I know who was around in heavy metal back then 1980/1981/1982/1983/1984 because I have been a Heavy Metal, fan since 1978. You never had no say on this subject matter for 36 years in the first place !!!!!!!!!!!!!!!!!!!!!!!!

prikaamaralheavymetallegend98797978987978978978954564

prikaamaralkickassmetalheavymetalhallofamelegend987686574563234

 

prikaamaralkickassmetalheavymetallegendtop10alltime9899674634523454234234

•••••••••••••••••

prikaamaralegaryholtworldsgreatestthrashers20the21stcentry989861223

nervosaheavymetallegendsmetalgodsheavymetalhallofamealbum978967856634412412a212321534

prikaamaralkickassmetal2016personoftheyearheavymetal98798798798776687423232

 

prikaamaraltop100heavymetalguiatristofalltimemetallegend98796786574a231131231213

 

prikaamaralnervosavictimofyourselftop100heavymetalalbumsofalltime97689866523a31223

 

prikaamaralnervosa2016lheavymetalguitaristoftheyeartop10guitaristofalltime989798654a1232453

 

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

 

nervosa2016heavymetalalbumoftheyearinstudio1162016a89795665

 

nervosaagony2016heavymetalablumoftheyear2916metalleegnds-9896968677546342345423234534

nervosathrashmetalgodsheavymetalhalloffamekickass978686574242143214124234343

amaral-lira-landa-eranervosametalgodsheaaymetallegends89879678564533424

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

nervosatop100heavymetalalbumofalltime99987978989784a20116

 

 

 

 

 

nervosathrash2016heavymetalablumoftheyearshinigamipostercd99999999a6577432

 

prika_amaral_kikcasmetasl_worldclassguitarist98798765423

prikamaralkickassmetalheavymetalhalloffamelegend987967867575464353442

 

 

 

 

 

 

nervosatop100heavymetalalbumofalltime99987978989784a20116

• • • • • • • • •

kickassmetalfernandaliraheavymetallegendhallofame9999789776753metalgods

 

Photo above Fernanda Lira * Nervosa FAME

KICK*ASS*METAL’S 2016 Person of the year….aka GREATEST WORLD-CLASS VOCALIST — HEAVY METAL — INTERNATIONAL

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

1983

Kate De Lombaert * Acid

kate_delombaert_worldsgresatestvocliast_1983999

 

kate_delombaert_kickassmetal1983

1984

Doro Pesch * Warlock

kam_doropesch_98574

1985

Leataher Leone * Chastain

leatherleonekickassmetal9857894689685

 

leatherleonekickassmetal8748763245

1986

Dawn Crosby * Détente

detentedawncrosbyheavymetallegendmetalgoddesshalloffame96785675463453453

1987

Claudia-Maria Mokri * Celtic Frost

1988

Jo Phillips * Masque

1989

Sabina Classen * Holy Moses

1990

Uta Gunther * Celtic Frost

1991

Dawn Crosby * Fear of God

1992

Sabina Classen *Holy Moses

kam_sabinaclausen-989789

1993

Martine van Loon * The Gathering

 

1994 * NORWAY

Kari Rueslåtten 3rd and the Mortal

1994 * INTERNATIONAL

Andrea Meyer * Cradle of Filth

 

1995 * NORWAY

Liv Kristine Espenæs * Theatre of Tragedy

1995 * INTERNATIONAL

Annke Van Giersbergen * INTERNATIONAL

 

1996 * NORWAY

Liv Kristine Espenæs * Theatre of Tragedy

 

1997 * NORWAY

Monika Edvardsen * Atrox

 

1998 * NORWAY

Vibeke Stene * Tristania

 

1999 * NORWAY

Kristin Fjellseth * Crest of Darkness

2000 * NORWAY

Kristin Fjellseth * Crest of Darkness

 

2001 * NORWAY

Anja Natasha * Dismal Euphony

2002 NORWAY

Miriam Elisabeth  Renvåg ** Ram-Zet

 

2003 * NORWAY

Kristin Fjellseth * Pale Forest

2003 * INTERNATIONAL

Sarah Jezebel Deva * Cradle of Filth

 

2004 * NORWAY

Liv Kristine * Leave Eye’s

2004 * INTERNATIONAL

Chibi * The Birthday Massacre

 

2005 * NORWAY

Miraim Elisabeth Renvåg *  Ram-Zet

2005 * INTERNATIONAL

Mia Coldheart * Crucified Barbara

crucifiedbarbraoneofthegreatestheavymetalartistofalltim9999999e89778955645453

 

2006 * NORWAY

Neil Sigland * Theatre of Tragedy

2006 * INTERNATIONAL

Dominique Persi * Stolen Babies

 

2007 * NORWAY

Emily A Saaen * Manes

 

2008 * NORWAY

Carmen Elise Espenæs  *Midnattsol

 

2009 * NORWAY

Neil Sigland * Theatre of Tragedy

 

2010 * NORWAY

Mariangela Demurtas * Tristania

2010 * INTERNATIONAL

Ashley Jurgermeyer * Cradle of Filth

 

2011 * NORWAY

Cecil Langlie *Omit

2011 * INTERNATIONAL

Margarita Monet * Edge of Paradise

 

2012 * NORWAY

Miriam Elisabeth Renvåg * Ram-Zet

2012 * INTERNATIONAL

Christine Davis * Christian Mistress

 

2013 * NORWAY

Catherine Paulsen * Trail of Tears

2013 * INTERNATIONAL

Lindsay Schoolcraft * Cradle of Filth

 

2014 * NORWAY

Carmen Elise Espenæs  * Savn

2014 * INTERNATIONAL

Sonja Ruppersburg * Terminatryx

 

2015 *NORWAY

Miriam Elisabeth Renvåg * Viper Solfa

2015 * INTERNATIONAL

Margarita Monet * Edge of Paradise

 

2016 * Norway

Kirsten Jørgensen

kristinjorgensonheavymetalhalloffamelegend98978989676452354223443

 

2016 * International

Fernanda Lira * Nervosa

nervosa_rulestheplanetmetal4ever

 

fernandaliragreatestworldclassvocalistheavymetal2016a98797696765646535

 

 

 

PERSON OF THE YEAR — WORLD’S GREATEST WORLD-CLASS VOCALIST — International

Fernanda Lira * Nervosa

nerovsafernadalira2016heavymetalalbumoftheyear2016

 

fernandaliranervosa2016kickassmetalpersonoftheyearworldsgreatestthrashmetalvocalistofasllitme9896986785674632

 

PERSON OF THE YEAR — WORLD’S GREATEST WORLD-CLASS VOCALIST — International

Kirsten Jørgensen * Evig Natt

 

2016 HEAVY METAL BASSIST OF THE YEAR

Fernanda Lira * Nervosa

kickassmetalfernandaliraheavymetallegendhallofame9999789776753metalgods

 

 

fernandaliraheaymetallegendisgodlegend897989897898797976666878678

 

2016 HEAVY METAL GUITAR PLAYER OF THE YEAR

Prika Amaral  * Nervosa

 

prikaamaralkickassmetalheavymetalhallofamelegend987686574563234

prikaamaralheavymetalheroguitargoddesslegend9897897897897897897898

PRIKA AMARAL HEAVY METAL GUITARIST OF THE YEAR 2012, 2014, 2016 …we are seeing a pattern here !!!

prikaamaralheavymetallegend98797978987978978978954564

 

Prika Amaral Nervosa founder

nervsoa_kam_file_prika_amaral_1398576_568253883223060_1130738908_o

prikaamaralkickassmetaltop20heavymetalguitaristofalltime98769879879879787986779889

prikaamaraltop100heavymetalguiatristofalltimemetallegend98796786574a231131231213

prikamaralworldclassguitaristnervosafame9895846

 

nervosametalgodskickassmetaslheavymetalhallofame9879768567643421

prikaamaraltop100heavymetalguitaristofalltime192016a98575544656463

prikamaralkickassmetalheavymetalhalloffamelegend987967867575464353442

 

2016 HEAVY METAL DRUMMER OF THE YEAR Pitchu Ferraz/Samantha Landa/, Nervosa  — 3 WAY TIE, SINCE 3 DRUMMERS HAVE SHARED THE NERVOSA LORD OF THUNDER metallic throne!!!!!!!!!!

Pitchu Ferraz

 

pitchuferraz_kickassmetal_nervosalegend_987987_9999

kickassmetallegendsnervosametalgods18797898796678567856754634

Samantha Landa

samanthalandakickassmetalhetalheavymetalhallofamelegend98798768657436

Photo Above Samantha Landa

Photo below Samantha Landa  Far left !!!

amaral-lira-landa-eranervosametalgodsheaaymetallegends89879678564533424

 

 

amaral-dametto-lira-eranervsoaheavymetallegnds98796786757543523424233523423423

Photo Above Luana Demetto Center

Photo Below Luana Dametto

 

luanadametttoheavymetalhalloffamemetallegend8978965621a32312312jpg

 

Best Heavy Metal Mixed Drink 2016

The Nervsoa

fernadaliradrinkingadrinkcalledthenervsoainventedinmilwakee9897685352

The Nervosa

thenervosaheavymetgalmixeddrinkkaugust232016milwakee9879766345234

OKAY The Nervosa Drink for sure happened on the East Coat Tour, this Drink Was invented By The Metal Grill August 21st, 2016 in Milwaukee, Wisconsin….!!!! I have a million memories since I started with Heavy Metal in 1978, but I know this is the correct real historic fact !!!!!

2016 ALBUM OF THE YEAR — NERVSOA “AGONY”

nervosaagony2016heavymetalalbumoftheyear2016989789789677634453454

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

2016 HEAVY METAL ALBUM OF THE YEAR –INTERNATIONAL

NERVOSA * VICTIM OF YOUSELF * JUNE 3RD, 2016 * NAPALM RECORDS * NPR664

2016 HEAVY METAL ALBUM OF THE YEAR — NORWAY

CREST OF DARKNESS * WELCOME THE DEAD * DECEMBER 2ND, 2016 * MY KINGDOM RECORDS

 nervosatop100heavymetalalbumofalltime99987978989784a20116

indisciplinekickassmetalheavymetaldebutalbum2016winnerskickassmetala8879789

 

2016 HEAVY METAL DEBUT ALBUM OF THE YEAR WINNER

INDISCIPLINE   * Rio de Janeiro, Brazil

 

 

 

This is a previous KICK*ASS*METAL article entitled

Fernanda Lira Biography The Greatest Thrash Metal Vocalist of the 21st Century — #1 World-Wide Ranking/ Rating 21st Century — TOP 10 of all-time.

 

 

 

nervosathefourhorsemenoftheapocalypse21stcentury987657846746374436347756767

FERNANDA LIRA ACHIVEMENTS

2014 DEBUT ALBUM OF THE YEAR – WINNER – INTERNATIONAL

2014 ALBUM OF THE YEAR WINNER – HEAVY METAL – WINNER – INTERNATIONAL

KICK*ASS*METAL HEAVY METAL HALL OF FAME INDUCTEE MARCH 2012 – ACHIVEMENT ONE OF THE GREATEST HEAVY METAL VIDEOS OF ALL-TIME

# 1 RANKED / RANKED THRASH METAL VOCALIST OF THE 21ST CENTURY

#1 RANKED / RATED THRASH METAL BASSIST OF THE 21ST CENTURY

# 10 RANKED / RATED HEAVY METAL BANDS OF ALL-TIME

TOP 100 HEAVY METAL ALBUMS OF ALL-TIME

TOP 100 EXTREME METAL ALBUM OF ALL-TIME

2016 ALBUM OF THE YEAR WINNER

2016 KICK*ASS*METAL PERSON OF THE YEAR —AKA Greatest World-Class Heavy Metal

2016 HEAVY METAL BASSIST OF THE YEAR

nervosarulesplanetmetal_9857674235963160940_o

FERANDA LIRA BIOGRAPHY NERVOSA OFFICIAL WEBITE

Well known and knowledgeable of the underground metal scene, Fernanda Lira blends energy and aggressiveness in her way of playing and behaving on stage.

Fernanda discovered her love for music early on, being influenced to play bass at age 13 by her father, also a bassist, and also by her biggest idol since childhood: Steve Harris of Iron Maiden. Self-taught, she never attended classes to develop her technique and punch, always using with her ears and dedication as the best allies in her musical journey. Still, her ability is always well recognized in her work and her compositions stand out. “She is very creative, and the most interesting fact is that her instrument is always very audible” commented Pierre Cortes, reviewer for the most trusted heavy metal site in Latin America, Whiplash.Net.

Eliminating the use of picks and dedicated to playing with her fingers, Fernanda does not hide her biggest influences. Aside from the aforementioned, she also admires and has always been inspired by bassists like Geezer Butler, Steve Di Giorgio, Geddy Lee, Ron Royce, and Markus Grosskopf , which is reflected in her bold attempt to take down from the bass the function of only ‘marking’ the rhythm of the music.

Her vocal inspirations are completely different. She has preferred since childhood to learn how to sing by imitating her metal idols such as Tarja Turunen, Michael Kiske and Geoff Tate. However, after working with more aggressive styled vocals on one of her previous bands, she began to migrate to a different style of singing, relying mostly on great idols such as vocalists/bassists Tom Araya of Slayer, and Schmier of the thrash legends, Destruction.

Currently, Fernanda Lira has been improving her old techniques and developing new ones, especially in regards to the vocal lines and compositions with Nervosa, and she also works as a musical journalist as broadcaster, reporter and photographer for the radio Heavy Nation at UOL and has her own production company of videoclips and promo pics for metal bands, called Alien – Foto & Video.

nervosarules_9766574331585094639901_n

*********

**************************

SECTION ABOVE FERNANDA LIRA BIO NERVOSA OFFICAL WEBSITE

***********************************

SECTION BELOW FERNANDA LIRA NERVOSA BAND BIO NERVOSA

**************************

*********

nervosa_allfemalethrashmetalband_brazil_97846876355745563

Female  thrash metal power trio from Sao Paulo, Brasil, formed by Fernanda Lira (bass and vocals), Prika Amaral (guitar and backing vocals) and Pitchu Ferraz (drums).
Even having been part of groups of different styles before, like death metal and crossover, all members see in the compositions of Nervosa the same passion: thrash metal. With strong influences from this genre’s classic school bands, the  girls in the band seek to bring up what is best in heavy music.
Prika Amaral started the band in February 2010, and in July 2011 Fernanda Lira took over the bass and vocals of NERVOSA, and only then, finally with the full team, the band started working as a professional band – writing, recording, doing shows.
In March 2012 the band released their first video for the song “Masked Betrayer”, which reached the incredible mark for a new band of 20,000 views in just one week, which led them to receive an honorable mention YouTube, ranking 17th place most viewed music video of the week and the 55th most watched in March of that year.
Because of the reputation earned through their hard work, NERVOSA in the following months accomplished a great achievement: the deal with the Austrian label Napalm Records, which has in its roster names like Cavalera Conspiracy, WASP, Grave Digger, Moonspell, Huntress, among many others.
In 2012, the first record of the band, a demo with three tracks, was released in Brazil on CD independently, under the title ’2012′ in August, and abroad via Napalm Records on vinyl in turquoise color, and via Nuclear Blast in clear version, both under the title ‘Time Of Death’, which cover art was designed by artist Andrei Bouzikov, who has worked with several bands before, such as Municipal Waste.
Nervosa ends the year of 2012 with a very positive balance of more than 50 shows made across the country, among them, sharing the stage with bands like Exodus, Raven, Grave, Samael (in Roça n Roll Festival), Exumer and Artillery , among others.
After a period of changing drummers, the girl who took over the drumsticks and came to join forces with the band in February 2013 was the competent Pitchu Ferraz, who carries a long 20-year career in the instrument.
The year of 2013 began with renewed energy, and the band continued promoting their EP nationwide, with shows in several states, and even with a tour around North and Northeast of Brazil, and sharing the stage with other major names, such as Korzus, Ratos de Porão and even Destruction, Exciter, Blaze Bayley, Kreator, DRI and Benediction.
In 2014, the girls finished recording their first full length, entitled Victim of Yourself, which featured 12 tracks and which cover was again signed by the artist Andrei Bouzikov, and which booklet was produced by the Brazilian artist Rafael Romanelli.
The album was released in March that year via Napalm Records in Europe and North America and by other labels and distributors in South America, Japan and Russia. In addition to the traditional format on CD, it was also launched four versions on vinyl in black, blue, red and transparent colors, with distribution by Napalm Records and also by Nuclear Blast.
Two videos were also released along the album promotion: ‘Death!’, which was recorded in an abandoned cemetery, reaching the record of views from all the videos of the band, and ‘Into Moshpit’, a compilation of live videos that demonstrates all the energy in the live show of the girls.
These two singles, added to other tracks on the album, made ‘Victim of Yourself’ reach great metal audience response, as well as highlight and good ratings in major magazines in this segment around the world, such as the European Metal Hammer, Rock Hard , Terrorizer and Bass Guitar, the American Revolver and Guitar World and even the Japanese Burrrn!, besides Brazil’s Roadie Crew, Bass Player, Guitar Player and Modern Drummer.
The good reception of the album was essential to result in a long and intense tour, which lasted for the years of 2014 and 2015. To promote the record, the band played in 17 of the Brazilian states, went through seven countries in Latin America and made a successful tour in Europe, with 51 shows in 60 days, passing through a total of 16 countries on the continent, including presentations on some of the major European summer festivals like Summerbreeze, Brutal Assault, Metal Days, Obscene Extreme, among others.
The band is currently doing the last shows of the tour ‘Victim of Yourself’ and finishing the writing of their new album, to be released in mid-2016.

nervosarulesplanetmetal_97865371287268840_n
*********
*********************
SECTION ABOVE NERVOSA OFFICAL BIOGRAPHY SECTION
*********************************
SECTION BELOW NERVOSA KICK*A*PEDIA ARTICLE…part KICK*ASS*METAL* part WIKIPEDIA.
THIS ARTICLE IS A KICK*ASS*METAL HEAVY METAL HALL OF FAME ANNOUNCEMENT. It was written eight days before the 2014 album of the year and the 2014 debut album of the year. The second band in heavy metal history to do so. The only other band in the heavy metal genre to have this feat is Crucified Barbara (SWEDEN), which happened in 2005
**********************
**********

545880_332074853507632_226929628_n

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

There is this website called Wikipedia, and lots of my favorite bands are there, because some bands are missed even by Metal archives/ BNR PAGES/ and Vampire Freaks (gothic/ industrial), so since Nervosa is not a featured band over at Wikipedia, here is my version of that page, not the Wikipedia but the KICKIPEDIA ( a KICK*ASS*METAL Wikipedia) tribute to NERVOSA !!
*********

*************************

**********************************

*************************

*********

Nervosa forms in

February, 2012

By World Class Guitarist Prika Amaral, with the help of Fernanda Terra

Prika Amaral KICK*ASS*METAL hall of fame member * rated top 100 guitarist in 1980’s style metal. Here @ KICK*ASS*METAL

Inducted in Riff Lord style (most unique) and inducted in thrash metal hall of fame (most authentic)
Inspired by artist such as Exodus, Slayer, Sepultura, Ratos de Porao, PanterA, and Napalm Death

July 2011 is when Nervosa really becomes the metal monster that I know and love today, this is when my favorite singer nowadays, whos other metallic weapon of choice is the bass. Fernanda Lira joins the band.

In the beginning of 2012 Karen Ramos opted to leave the band.

KAREN RAMOS IS A KICK*ASS*METAL HALL OF FAME MEMBER * these days she is in a alternative rock band called FUSS, l@@king forward to reviewing your future endeavors…Karen Ramos !!!!!

So now the band is a POWER TRIO, that plays with POWER. I would of worshipped hard Nervosa no matter what, but I have a affinity of Power trio’s and as a fan of this METALLIC configuration, I feel blessed to have Nerovsa in this style. Some of my favorite bands of all time are power trio’s.

9876_987654321_2012_666

In March 2012, one of the greatest videos of alltime was released Nervosa’s “Masked Betrayer”. I start every day of with this video, killer guitar tones, and major rager metal vibes.

Sometime after this Nervosa signs a mangment deal with Jeff Keller.

In August 16th, 2012 Nervosa Released, the 2012 Demo, with the tracks “Time of Death”, “Invisible Oppression”, and the mindblowing a kick*ass song “Masked Betrayer”

This was re-released by Napalm Records on September 21,2012 as “Time of Death” EP.

Re-released by Napalm Records September 21, 2012 as an EP entitled “Time of Death” (cover shown below) with the following pressings:

7″ strictly limited to 150 copies in turquoise vinyl and
7″ strictly limited to 150 copies in clear vinyl.

Re-released in March 2013 by Napalm Records:
7″ strictly limited to 150 copies in red vinyl and
7″ strictly limited to 150 copies in purple vinyl.

Catalog number NPR454

The Catalogue number is Napalm Records NPR 454

The KICK*ASS*METAL rating for this is 100 out of 100 blood dripping skulls.
This is in my to review pile, my desk always has a few hundred recording to review.

The drummer Jully Lee, replaces original drummer Fernada Terra, and Enters fold the NERVOSA sometime in 2102 and departs in mid to mid/late 2013.

In June 20th, 2013 Nervosa announces new drummer Pitchu Ferraz

So now a this time, cira June 2013. The Lira/ Amaral/ Ferraz Line-up the band is the golden-era of the band, and as much as I love the Lira/ Amaral/ Terra- era of the band. I think the Lira/ Amaral/ Ferraz -era of the band is going to be the bands golden-era/ vintage-era/ . Even though the first line-up are vintage and classic; With Lira/ Amaral/ Ferraz. The band is going to have a golden era, within a golden era.

January 2014 Nervosa is nominated to the KICK*ASS*METAL HALL OF FAME, even though the focus of KICK*ASS*METAL is Symphonic Black Metal of the Beauty and the beast configuration, and Gothic Metal, of the beauty and the beast configuration and all music avant-garde. “All World Class Artist should be supported no matter what sub-genre or what part of the world the band hails from. Nervosa hails from Brazil, even though I cover tons of stuffs from Norway, Nervosa f!@#$%8 RULES”. Quote the KICK*ASS metal team.

Feb 17, 2014 a KICK*ASS*METAL top 10 video titled death was unleashed on Planet Metal, and it ruled over all !!!

Feb 17, 2014 a KICK*ASS*METAL top 10 video titled death was unleashed on Planet Metal, and it ruled over all !!!

It earned a full score of 100 out of 100 blood dripping skulls.

FEB 28, 2014 * Nervosa * ” Vicitm of yourself” is voted KICK*ASS*METAL’s top 10 album of the year. And the 34th band in 1980’s / 1990’s, thrash/ death or thrash / death style to win this disctionn what later became known as extreme metal, or the true metal .

February 21st 2014 * 7 days before the DEBUT METAL album of the year is released.

The World Class Joao Durante created website, for the metal hero’s goes online this killer contact is

http://www.nervosaofficial.com

Discography
2012 Self financed EP 100 out of 100 blood dripping skulls
2012 Time of Death * 100 out of 100 blood dripping skulls
2013 Time of Death 2nd re-release * 100 out of 100 blood dripping skulls.

March 11, 2014 “Victim of Yourself” * 100 out of 100 blood dripping skulls

Achivements
March 2012 Masked betrayer, top 10 metal video of all-time voted by KICK*ASS*METAL

August 2012 Time of Death, top EP of 2012, top albums of all-time list in the works

Mid 2013 Fernanda Lira…Nominiated TO KICK*ASS*METALS, best and most important vocalist of all time…Best of the best category, and favorites vocalist category.

Januray 2014 Nervosa Nominated to the KICK*ASS*METAL hall of fame

January 2014, Nervosa “VICITM OF YOURSELF” albums appears, on the best of the best list of most original and most molten relesase in the traditional metal RIFF LORD style. Nervosa will be on another list called the best of thrash metal, aka THE THRASHING 300.

March 11, 2014 Top 10 album of 2014

March 11, 2014 DEBUT album of the year, unless a more vicious band releases material that is more hungry for glory than Nerovsa, but I just can not see it happening, before March 11, 2014.

*********************
*************************
******************************
*********************************
***********************************
this section here is the insights on Nervosa induction into the KICK*ASS*METAL hall of fame

“I started with NWOBHM in September 1980, because there was no GOTHIC Metal until November of 1987, so I got to know the golden-era of all extreme, and true metal’s. And Nervosa captures those vibes. I want to see Nervosa as a beloved band in the Symphonic & Gothic metal movement’s. Because Nerovsa is a band who’s Vocalist Fernanda Lira, is the real deal, and every fan of World Class Vocalist should really pay attention to not only her timbre, but delivery, Fernanda Lira is the real deal.” Quote The KICK*ASS*METAL Team

As far as the bands music, goes, what I love about Nervosa, is that there songs are so powerful, and original in there vibe, I just want to always listen to there brand of heavy metal. When there debut album “Victim of Yourself” is released Stateside, March 11th, 2014. I am purchasing 4 copies, stateside, and look for every worldwide pressing, and I am especially looking forward the Japanese Pressing” Quote the KICK*ASS*METAL team.

So trench coat mafia robed ragers, and Robed Ragers, of industrialized/ gothic/death/black metal styles. When March 11th, 2014 happens stateside. When looking in the bins for gothic artist such as Septic Flesh, Beseech, and industrial artist such as Xe-NONE & Hanzel Und Gretyl, Look for Nervosa “VICTIM OF YOURSELF”.

Because @ the heart of all good gothic MODERN music, is thrash and death metal and black metal. And one must learn the importance of thrash and rage…and bang your head until it l@@ks like a bloody pancake!!!!

Long Live Nervosa !!!!!!!

**************************************

NERVOSA, the all-female thrash metal act from Rio de Janeiro, Brazil, will release its debut album, “Victim Of Yourself”, on March 11 in North America via Napalm Records. The production, recording, mixing and mastering were taken care of by Heros Trench and Pompeu, both of the veteran Brazilian metal band KORZUS. The recordings took place at the studio Mr. Som, where NERVOSA recorded its first EP, entitled “Time Of Death”, in 2012.

According to a press release, “the all-female thrash metal combo pushes the pedal to the metal and offers the listener high-speed riffs, furious drumming and raging leads. The songs have a brutal and raw energy and are crowned by murderous hooks and the aggressive vocals by bassist Fernanda Lira.”

“Victim Of Yourself” track listing:

01. Intro
02. Twisted Values
03. Justice Be Done
04. Wake Up and Fight
05. Nasty Injury
06. Envious
07. Morbid Courage
08. Death
09. Into Mosh Pit
10. Deep Misery
11. Victim of Yourself
12. Uranio Em Nos

“Victim Of Yourself” release dates:

February 28: GAS, Finland, Benelux
March 5: Spain, Sweden, Norway
March 3: Rest of Europe
March 11: USA, Canada

NERVOSA is:

Fernanda Lira – Vocals, Bass
Prika Amaral – Guitar, Backing Vocals
Pitchu Ferraz – Drums

Remember to play Nervosa thrash @ maximum volume…!!!

…and Bang your head until your brain l@@ks like a bloody pancake!!!!!!!!!

Thrash and Rage !!!!!

Here is the hall of fame list, where NERVOSA was nominated by KICK*ASS*METAL
Abattoir- Vicious Attack
Accept- Restless and Wild
Acid- Acid
ACID * MANIAC
ACID LIVE IN BELGIUM ’84
Agent Steel- Skeptics Apocalypse
Agent Steel * Mad Locust Rising
Anacrusis- Screams and Whispers.
ANGEL DUST- INTO THE DARK PAST
Angel Witch * Angel Witch
ANNIHILATOR * ALICE IN HELL
Annihilator * Never, Neverland
ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS
Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS
Anthrax * Spreading the Disease … features songs written by Neil Turbin…
Anvil- Metal on Metal
ANVIL- FORGED IN FIRE
Anvil- Live in concert
Anvil-Worth the weight
ANVIL CHORUS * THOUGHT CRIMES
Anvil Chorus * The Killing Sun
Artillery * Fear Of Tomorrow
ARTILLERY * TERROR SQUAD
ARTILLERY * By Inheritance
ATHEIST- PIECE OF TIME
ATHEIST- UNQUESTIONABLE PRESENCE
Attacker-Battle at Helms Deep
Attacker-Second Coming

BATHROY * BATHORY
Bathory * The Return…
Bitch * Damnation Alley
Bitch- Be My Slave
Black Death * Black Death * Auburn Records
Black Sabbath- Mob Rules
BLIND ILLUSION- THE SANE ASYLUM
Bloodlust – Guilty As Sin
BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS
BLITZKRIEG * A TIME OF CHANGES
Bulldozer * The Day of Wrath
Bulldozer * the Final Seperation
Bulldozer * IX

CACOPHONY- SPEED METAL SYMPHONY
Cage- Astromy
Candlemass-Nightfall
Carnivore * Carnivore
Cathedral- Supernatural Birth Machine
CELTIC FROST- MORBID TALES
Celtic Frost- Emperors Return
Celtic Frost- To Mega therion
CELTIC FROST- INTO THE PANDEMONIUM
Chastain * Mystery of Illusion
Chastain * Ruler of the Wasteland
Chastain * The 7th of Never
Chastain * The Voice of Cult
Chastain- For those who Dare
CHASTAIN- IN A OUTRAGE
COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE
COVEN * Worship New Gods…Coven …aka Coven13
CIRITH UNGOL * FROST AND FIRE
CIRITH UNGOL * KING OF THE DEAD
Crimson Glory- Crimson Glory
CRYPTIC SLAUGHTER * CONVICTED
Culprit- Guilty As Charged
CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld
Dark Angel * We Have Arrived
DARK ANGEL * DARKNESS DESCENDS
DARK ANGEL * LEAVE SCARS
DEF DEALER * KEEPER OF THE FLAME
DEF DEALER * JOURNEY INTO FEAR
DEATH- SCREAM BLOODY GORE
DEATH * LEPORSY
DEATH- SPIRITUAL HEALING
DEATH- HUMAN
DEATH-INDIVIDUAL THOUGH PATTERNS
DEATH * Symbolic
Death Angel- The Ultra-Violence
DEATH ANGEL- ACT III
Death Strike-Fuckin’ Death
Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe
Ded Engine * Hot Shot
Ded Engine * Hold A Grudge
Deep Switch- Nine inches of God
DESTRUCTION- INFERNAL OVERKILL
Diamond Head * Diamond Head…1980 …aka Lightning to the Nations
Diamond Head- Lightning to the Nations
Diamond Head- Behold the Beginning
Discharge * Hear Nothing, See Nothing, Say Nothing
Dream Death- Journey Into Mystery
DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC
Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS
ECXICER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS
Exhorder- Slaughter in the Vatican
EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE
EXODUS- BONDED BY BLOOD
EXODUS- PLEASURES OF THE FLESH
EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)
EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)
EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)
Exorcist * Nightmare Theatre
EXUMER * POSSESSED BY FIRE

FATES WARNING * NIGHT ON BROKEN
Fear of God * Within The Veil
FORBIDDEN- FORBIDDEN EVIL
FORBIDDEDN * TWISTED INTO FORM

Girlschool * Hit and Run
GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS
GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS
THE GREAT KAT- WORSHIP ME OR DIE!
THE GREAT KAT- BEETHOVEN ON SPEED
THE GREAT KAT- BEETHOVEN SHREDS
Griffin- Flight of the Griffin

Hawaii- One Nation Underground
HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK
HALLOWEEN- DON’T METAL WITH EVIL
Hell- Hell (1982)…Demos come with 2 disc version of 2011 CD
H-Bomb- Attaque
HEATHEN- BREAKING THE SILENCE
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now

Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS
Iron Maiden- The Number of the Beast

Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller

Killer * Wall of Sound
Killer- Shock Waves
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
Massacre- From Beyond
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE

MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- NO LIFE TIL LEATHER
METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview
METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end
METALLICA* LIVE * METAL UP YOUR ASS..1983 DEMO CASSETTE
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Metallica- Creeping Death/ Jump in the Fire CD
Metallica- Master of Puppets
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron

Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE

402785_401602163221567_1813400390_n

Nervosa (Brazil) * TIME OF DEATH

NERVOSA (thrash brazil) *VICTIM OF YOURSELF

nervosa_kam_file_illovenervosa_542222_533645260017256_1720890417_n

Nightmare * Astral Deliverance
NME * UNHOLY DEATH

OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilevon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power
RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE
RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swalled in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO
SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
Saxon * Denim and Leather
Scorpions- Taken By Force
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD
SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS
SUICDIAL TENDENCIES * SUICIDAL TENDENCES
SYRIS * Unseen Forces

Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy
THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS
THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
The Rods* Wild Dogs
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error

Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
Warlord-Deliver Us
Warlord * And The Cannons Of Desturuction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
Whiplash * Power & Pain
Whiplash * Ticket to Mayhem
Wildestarr * Arrival
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon

Znowhite * All Hail to Thee
Znowhite * Live Suicide
Znowhite * Act of God
Zoetrope * Amnesty
Zoser Mez- Vizer of Wasteland

Abomination * Abomination

Absu * Tara

Acid * Maniac

Aeternus * Shadows of Old

Altar * Provoke

Andralls * Inner Trama

Annihilaitor * Alice In Hell

Annihilator * Never, Neverland

Annhiliator * Criteria for a Black Widow

Annihilator * Waking The Fury

Anthrax * Fistful of Metal

Anthrax * Armed and Dangerous

Anthrax * Spreading the Disease

Arch Enemy * Wages of Sin

Arch Enemy * Anthems of Rebellion

Artillery * Terror Squad

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

Assasin * The Upcoming Terror

Asphyx * The Rack

Asphyx* Last on Earth

Asphx* Asphyx

Atrocity * Hallucinations

Atrophy * socialize Hate

Atrophy * Violent By Nature

Avenger of Blood * Death Brigade

Barbatos * War! Speed And Power

Bathory * Bathory

Bathory * Blood Fired Death

Bathory * Under the Sign of the Black Mark

Believer * Extraction From Mortality

Bestial Warlust * Vengence War til Death

Bewitched * Spiritual Warfare

Blind Illuisin * The Sane Asylum

Black Task * Death And Damnation

Broken Bones * Bonecrusher

Brujeria * Raza Odiada

Bolt Thrower * In the Battle There is No law

Bolt Thrower * Realms of Choas…Slaves To Darkness

Burnt Offering * Burnt Offering

Burnt Offering * Walk of The Dead

Burn To Black * Mach 666

Cancer * To the Gory End

Cancer * Death Shall Rise

Cancer * The Sins of Mankind

Carnivore * Carnivore

Carcass * Heartwork

Carnage Dark Recollections

Coroner * RIP

Coroner * Punishment for decadence

Celtic Frost * Morbid Tales

Celtic Frost * Into the Pandemonium

Criminal * Dead Soul

Crown of Thorns * Eternal Death

Cryptic Slaughter * Convicted

Dark Angel * We Have Arrived

Death Angel * The Ultra-Violence

Darkness * Deathsquad

Death Angel * Frolic Through The Park

Death Angel * Act III

Death * Scream Bloody Gore

Death * Leporsy

Death * Spiritual Healing

Death * Human

Death * Individual Though Patterns

Deceased * Fearless Undead Machines

Dekapitator * We Will Destroy…You Will Obey

Deathwish * At the Edge of Eternity

Defleshed * Fast Forward

Desaser * Satans Soliders Synidicate

Desultory * Into Eternity

Destroyer666 * Unchain The Wolves

Deicide * Deicide

Deicide * Legion

Détente * Recognize No Authority

Destructor * Maximum Destruction

Destruction * Infernal Overkill

Dew-Scented * Inwards

Dissection * The Somberlain

Energetic Crusher * Path To Oblivion

Engrave * The Rebirth

Entomed * Left Hand Path

Entomed * Clandesting

Epidemic * Decameron

Exciter * Heavy Metal Maniac

Exciter * Violence and Force

Exodus * A Lesson In Violence * 1984 advance cassette

Exodus * Bonded By Blood

Exodus * Pleasures of the Flesh

Exodus * A Lesson In Violence CD COMBAT 1991 CD (deleted but copies got out, I have 2)
Ultimate Revenge soundtrack + 1986 Paul Baloff Demo

Not the bulls!@* “Lessons In Violence” best of
CD that Relativity made, because they were getting
read to close COMBAT RECORDS doors.

Exodus * Another Lesson In Violence * 1997 Century Media LIVE

Exodus * Bonded By Baloff * 1991 “A Lesson In Violence” Delete CD remastered and it is
heavy as f!@*

Exhorder * Slaughter in the Vatican

Extreme Noise Terror* Retrobution

Exumer * Possessed By Fire

Farscape * Demon’s Massacre

Fatal Embrace * THe Ultimate Agression

Forbidden * Forbidden Evil

Forbidden * Twisted Into Form

Fueled By Fire * Spread The Fire

Gammacide * Victims of Sciene

GBH* Midnight Madness and Beyond

Gehenna * Malice

Ghoul * Mainaxe

Grinder * Dawn For The Living

Guillotine * Under The Guillotine

Hallows Eve * Tales of Terro

Heathen * Breaking The Silence

Heathen * Victims of Deception

Hellhammer * Apocalyptic Raids

Hellstorm (NORWAY) * Fucking Bleeding

Hellish Crossfire * Slayer of The Burning Pentagram

Hexx * Quest for Sanity

Hirax * Raging Violence

Holy Moses * Strength, Will Passion

Horned God* Choas, Bringers of all Relevations

Horrific * Your Worst Nightmare

Hypnosia * Extreme Agression

Imagaika * Imagaika

Imagika * Worship

Incubus * Serpent Temptation

Incubus * Beyond The Unknown

Internal Bleeding * Voracious Contempt

Internal Bleeding * The Extinction of Benevolence

Internal Bleeding * Driven To Conquer

Internal Bleeding * Onward to Mecca

Intruder * A Higher Form of Killing

Insanity * Death after Death

Infernal Majesty * None Shall Defy

Inferno * Uter Hell

Iperypt * Totalitarian Love Pulse

Jungle Rot* Skin The Living

Jungle Rot * Slaughter The Weak

Jungle Rot * Darkness Fortold

Jungle Rot * Dead And Buried

Jungle Rot * Fuled By Hatred

Jungle Rot * WarZone

Jungle Rot * What Horror Awaits

Jungle Rot * Kill on Command

Jungle Rot * Terror Regime

Killaman * Killaman

Kings Evil * Deletion of Humanoise

Kreator * Endless Pain

Kreator * Pleasure To Kill

Krisiun * Unmerciful Order

Krisiun * Black Force Domain

Krisiun * Apocalyptic Revelation

Krisiun * Conquerors Of Armageddon

Krisiun * Ageless Venomous

Krisiun * Works of Carnage

Krisiun * Bloodsheed

Krisiun * Assassination

Laaz Rocket * Know Your Enemy

Laaz Rocket * Annihilation Principle

Massacra * Final Holocaust

Master * Master

Master * Unreleased 1985 album one CD

Massacre * From Beyond

Macbre * Gloom

Maze of Torment * Faster Disaster

Megadeath * Peace Sells…But Who’s Buying

Megadeath * So Far So Good…So What

Megadeath * Rust in Peace

Messiah * Choir of Horrors

Merciless * The Awaking

Merciless Death * Evil In the Night

Merciless Death * Realm of Terror

Mercyless * Abject Offerings

Metallica * No Life Til Leather

Metallica * Kill em All

Metallica * Ride the Lightning

Metallica * Master of Puppets

Metal Church * Metal Church

Morbid Angel * Altars of Madness

Morbid Angel * Blessed are the Sick

Morbid Angel * Covenant

Morbid Angel * Entangled In chaos

Morbid Angel * Formulas Fatal To the Flesh

Morbid Angel * Gateways To Annihilation

Morbid Angel * Heretic

Morgoth * Resurrection Absurd

Nasty Savage * indulgence

Napalm Death * Harmony Corruption

Nervosa * 2012 EP * Self Realized by Nervosa
August 16, 2012
Nervosa * TIME OF DEATH EP 1st Napalm Records Pressing
September 2012
Nervosa * TIME OF DEATH EP 2nd Napalm Records Pressing
March 2013
Nervosa * Victim of Yourself
For this publication my day of thrash metal salvation happens on March 11, 2014. !!
“Victim Of Yourself” Release Dates:
28.02.2014 GAS/FIN & BENELUX
03.03.2014 UK/Rest of Europe
05.03.2014 ESP/SWE/NOR
11.03.2014 USA/CAN

Occult * Of Flesh and Blood

Occult * Rage to Revenge

Occult * Elegy for the Weak

Pentagram * Chile * Pentagram CD 2000 Picoroco

Pantera * Cowboys from Hell

Pantera * Vulgar Display of Power

Pestilence * Malleus Maleficarum

Pestilence * Consuming Impulse

Possessed * Seven Churches

Possessed * Beyond The Gates

Sabbat (Nippon) *Envenom

Sabbat (Nippon) *Envoke

Sabbat (Nippon) *Disembody

Sabbat (Nippon) *Fetishism

Sabbat (Nippon) *Karisma

Sabbat (Nippon) *Karmagmassacre

Sabbat (Nippon) *And the Sabbatical Queen

Sabbat (Nippon) *To Praise the Sabbatical Queen

Sabbat (Nippon) *Sabbatrinity

SABBAT * (UNTIED KINGDOM) “History of a Time to Come”

Sacrifice * Forward to Termination

Sacrifice * Soldiers of Misfortune

Sacrifice * Apocalypse Insie

Sepultura * Morbid Visions

Sepultua * Schizophrenia

Sepultura * Beneath The Remains

Sepultura * Arise

Sindrome * Sindrome (2 demos on 1 CD, pressing officially once, bootlegged twice)

Slaughter (Canada) * Strappado

Slayer * Show No Mercy

Slayer * Haunting The Chapel

Slayer * Hell Awaits

Slayer * Reign in Blood

Stromtroopers Of Death…aka SOD * Speak English or Die

Suicidal Tendencies * Suicidal Tendencies

Testament * The Legacy

Terrorizer * World Downfall

Torture Squad * Asylum of Shadows

Torture Squad * The Unholy Spell

Torture Squad * Pandemonium

Torture Squad * Hellbound

Torture Squad * Aequilbrium

Unseen Terror * Human Error

Vader * The Ultimate Incantation

Vader * De Profundis

Vader * Reborn In Chaos

Vader * Litnay

Vader * Relevations

Vader * The Beast

Vader * Necropolis

Venom * Welcome to Hell

Venom * Black Metal

Vexed * Nightmare Holocaust

Vermefug * Wet Nightmare

Viking * Do Or Die

Virus * Pray for War

Vital Remains * Forever Underground

Vital Remains * Dawn of The Apcolypse

Vital Remains * Dechristainize

Voi Vod * War and Pain

Voi Vod * RRRRROOOOAAAARRR

Voi Vod * Killing Technology

Watchtower * Energetic Disassembly

Watchtower * Control and Resistance

War* Total War

Warbringer * War Without End

Warhead * The Day After

Wargasm * Why Play Around?

Witchburner * Blood of Witches

Witchery * Restless and Dead

Witchery * Dead, Hot, and Ready

Witchery * Symphony For the Devil

Witchery * Don’t Fear The Reaper

Witchery * Witchkreig

Witchtrap * No Anesthesia

Whiplash * Power and Pain

Whiplash * Insult To Injury

Whiplash * Thrashback

Znowhite * All Hail to Thee

Znowhite * Live Suicide

Znowhite * Act of God

Zoetrope * Amnesty

Zyklon * World ov Worms

Zyklon * Aeon

Zyklon * Disintergrate

90% of the worlds webzines have no taste in metal, and basically legendary artist are allowed to be slander by journalist WHO DO NOT EVEN OWN The albums, which they are slagging off on…arrggghhh.

While others are fumbling through useless metal collectors books, and getting a 4 out of a 10 rating review for a album is legndary and pioneering. Snag it from those fools and get 8 or 9 back up copies of these legendary metal titles. Print this out, and carry it in your back pocket, or print it out and tape it to your computer, and enjoy the realm of KICK*ASS heavy METAL !!!!!!!!!

Most collector books on heavy metal are written by the readership of Rolling Stone magazine or worse, the people WHO ACTUALLY WRITE FOR THEM..aaarrggghhh !

“Support MUSIC and NOT RUMORS” a quote by the founding father of Death Metal, and KICK*ASS*METAL’S philosophy

NERVOSA’S facebook presence

https://www.facebook.com/femalethrash

NERVOSA’s youtube presence

http://www.youtube.com/user/NERVOSAthrash

Here is a bio section from a previous articles

“Power female trio thrash metal of São Paulo, formed by Fernanda Lira (bass and vocals), Prika Amaral (guitar and backing vocals) and Pitchu Ferraz (drums). Even having been part of groups of different styles before, death metal and crossover , all members see in the compositions of the same passion Nervosa: thrash metal. With strong influences coming from bands of the classical school of style, the girls band seeking rescue what is best in heavy music. Prika Amaral started the band in February 2010, but only in July 2011 Fernanda Lira took down and the vocal NERVOSA.

In March 2012 the band released their first video for the song “Masked Betrayer”, which reached a staggering 20 thousand views in just one week, which led them to receive an Honorable Mention YouTube, ranking 17th Place clips Most viewed musicians of the week and 55th most viewed in March. Thanks to the notoriety earned through their hard work, the NERVE in the following months, got two other great achievements. was the first management contract with American Jeff Keller, also representative of other great bands on the world stage, like Destruction and Hirax. Another novelty was the contract with the Austrian label Napalm Records, who has on his roster names like Grave Digger, Hate, Tiamat, Huntress, and others.

The band’s first record, a demo with 3 tracks, was released in Brazil on CD independently, under the heading ‘2012 ‘in August, and overseas via Napalm Records on vinyl in turquoise color, and via Nuclear Blast in version transparent, both under the title of ‘Time Of Death’, whose cover art was drawn by photographer Andrei Bouzikov, who has worked with several bands before, and Municipal Waste. Nervosa

A closes the year 2012 with a very positive balance over 50 shows done around the country, among them, sharing the stage with bands like Exodus, Raven, Grave, Samael (the Roça n Roll festival), and Exumer Artillery, among others. After a period of exchange of drummers, who assumed the post and came to join the band forces in February 2013 was the competent Pitchu Ferraz, who carries a long career of 20 years in the instrument.

Thus, the year 2013 began with renewed pike, and the band continued to spread his EP nationwide, with shows in several states, and including a tour of the North and Northeast, as well as sharing the stage with other big names from the world stage as Korzus, Bilge Rats and still Destruction, Exciter, Blaze Bayley, Kreator , DRI and Benediction. Moreover, the recording of their first full-length album, to be released worldwide in February next year, have been finalized and the band now focuses on plans for dissemination of the same in 2014.

– Fernanda Lira –
Nervosa
Fernanda Lira – Bass and Vocals
Known and knowledgeable of the underground metal scene, Fernanda Lira upsets any stereotype that girls do not know how to play heavy music.Merging energy and aggression in her playing and behave onstage, the bassist and vocalist come for several years, advocating and raising the flag of the passion for metal.
Fernanda discovered her love for music at an early age, being influenced playing bass at age 13 by her father, also a bassist, and also by her biggest idol from childhood: Steve Harris, the band Iron Maiden.
Self-taught, never attended classes to develop their technical and footprint, always with his ear and dedication as best allies in this musical journey. Still, her ability is always well recognized in their work and in their compositions stand down because “the play dramatically. She is very creative and more interesting is precisely the fact of his instrument always be quite audible” commented Pierre Cortes, reviewer of the most trusted heavy metal in Latin America, Whiplash.Net.
Eliminating the use of blades and investing in ridings with fingers, Fernanda does not hide her biggest influences: besides the aforementioned, she also admires and has always been inspired by bassists such as Geezer Butler, Steve Di Giorgio, Geddy Lee, Ron Royce and Markus Grosskopf , which is reflected in its bold attempts to take down the function of only ‘mark’ the rhythm of the songs.
Have her vocal inspirations are completely different. Preferred since childhood to learn to sing and imitate their idols like Tarja Turunen metal, Geoff Tate and Michael Kiske. However, after experiencing more torn backing vocals on one of her previous bands, began to migrate to a different style of singing, relying mostly on large vocalists and bassists idols like Tom Araya, Slayer, and Schmier, Destruction of thrash legend.
Fernanda started her career in bands at age 15, in a group that blended with traditional melodic metal. Soon after, she formed along a former bandmate to Hellarise, with whom she recorded her first audio record, which got some success: thanks to the record where his low “draws attention so incredible” (Christiano KODA, Whiplash. Net), this former band was featured in an issue of the magazine Roadie Crew and was selected to the São Paulo round the Wacken Metal Battle.
For reasons of personal and musical differences divergence, Fernanda was removed from this former band, for no more want to follow the cliché that is emerging among bands with female component, which is to practice the musical lines similar to the vocalist Angela Gossow of Arch and her cronies Enemy, for example.
Judging by his way of composing, Fernanda has always maintained a greater preference to the style that provides fast thrash metal, and after some time away from the scene, the bassist went to look for new members to form a new group of metal, this time making a sound purely thrash, and preferably, old school. After several attempts, she was invited to participate in Nervosa, where she took both posts bassist and vocalist, and who is conquering its space again on the scene, closing major partnerships and sponsorships for the band, and playing through several states in Brazil.
Currently, Fernanda Lira has been improving their old techniques and developing new, especially as regards the vocal lines and compositions with Nervosa, and works in the area of music journalism, as a reporter and photographer from radio Heavy Nation of UOL, and columnist for the site Whiplash.Net.
– Prika Amaral –
Prika Amaral
Guitar and Backing Vocals
Prika Amaral has always had the musicality very present in your life. Since birth she heard her father play guitar and guitar.Passionate about music, interest in learning to play has always been evident.What stopped was the difference in musical styles, but that was when at age 14 decided to learn the guitar alone, in two years fingering techniques learned how classical guitar, and by that time well developed these skills.
But this was not the musical style which she dreamed of playing, it was then that the lower the tone of the guitar for 2 tones she began to feel more comfortable, thereafter began a series of compositions. At the age of 18 in her first job, got her first paycheck and was rushing to buy your guitar. Soon after she formed his first band called Kaostone’s (band formed only by women). Remained alone for a year chasing members without success to find suitable members quit the band.
Throughout that time bands were 10 and 7 projects. Among them are the main Caeté Innervoices and Black Mud. Already renowned as a guitarist came to do some vocals in bands like Caeté plus guitarist and now also operates in the backing vocals Nervosa.
The style of guitar playing Prika Amaral, always drew attention for this incredible technique extremely fast and full of horseback riding in complex times picking. Of course one can notice his strong influence on thrash metal style that she claims to be an expert in playing. Quick solos, use of leverage and microfonias, can be heard in her work. Enhancing techniques, has surprised everyone. But beyond that, the accolades are huge when it comes to composition, choices, combinations and creativity, always highlighted, see the songs Nervosa: “Time of death,” Invisible Oppression “,” Uranium in us “and” Masked betrayer “, whose melodies were all made and designed entirely by Prika Amaral.
When it comes to lyrics, always present with their inspirations and revolts, which can also be observed in Nervosa, this current band.
Her biggest influences are Dimebag Darrell on guitar (Pantera), Jimi Hendrix, Kerry King (Slayer), Eric Peterson (Testament), Buddy Guy, David Gilmor (Pink Floyd), Gary Holt (Exodus) and Tony Iommi (Black Sabbath).
Throughout this time people were always sought to take seriously a band, and is very visible satisfaction in having established and be participating in Nervosa.
In addition to guitarist Prika is Administrator, founded the label Dirty Records, promotes events and is always involved and organizing cultural projects. This can all be checked in your curriculum with many important events in the underground scene.

She has participated and organized tours, playing in many places, always present not only in the local scene, but is recognized in many places throughout Brazil.”

Nervosa drummer is Pitch Ferraz

BAND PICS circa Mid 2013
World Class Vocalist / World Class Bassist and METAL GODDESS and heavy metal hero * Fernanda Lira
World Class Guitarist/ Backing Vocalist and METAL GODESS and heavy metal hero * Prika Amaral

World Class Drummer and METAL GODDESS and heavy metal hero * Pitch Ferraz

Remember to play Nervosa thrash @ maximum volume…!!!

…and Bang your head until your brain l@@ks like a bloody pancake!!!!!!!!!

Thrash and Rage !!!!!

545880_332074853507632_226929628_n

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

*********

*************************

Above KICK*ASS*METAL * Febraury 20th, 2014 KICK*ASS*METAL article about the bands March 2012 KICK*ASS*METAL HEAVY METAL HALL OF FAME INDUCTION INTO THE KICK*ASS*METAL HEAVY METAL HALL OF FAME

**********************************

Below Fernanda Lira-0-graphy * World Class Vocalist Spotlight * Fernanda Lira * NERVOSA thrash (GODS) Brazil fame — March 27th, 2014 Article * Includes Discography

**********************************

***************************

*********

Picture above Promo photo session for the legendary 2014 PROMO photo sessions

Here is my new favorite vocalist nowadays Fernanda Lira, wearing a KICK*ASS*METAL, all time favorite band Mercyful Fate t-shirt, since October 1982, or so when their first EP came out, when I was in 9th grade, back in 1982/1983 school year
Nervosa_Kam_file_1555324_591802120868236_2011550031_n

Here is a top 10 favorite video of all time, I start my day of with this then I go and get coffee and energy drinks ( I prefer NOS over the others)…this video really gets the blood flowing and whips me into a frenzy!!!

Besides being a World Class Vocalist her other METALLIC WEAPON OF CHOICE is the BASS GUITAR.

Nerovsa is a POWER TRIO, that plays with talent, conviction and most importantly POWER

Here are 2 KICK*ASS*METAL hall of fame members in the same photo. Fernanda Lira NERVOSA FAME,and DORO PESCH Warlock and Doro FAME..!! Fernanda Lira is wearing a SLAYER t-shirt in this one. Every 1980’s metal fan, worship Slayer since debut album in December 1983. “Show NO Mercy” was released, right around Christmas winter break, circa 1983/1984. My 10th grade, school year.

***********
*******************

this is an older article updated with more info.

So since that time a new video emerged and it is called

Nervosa Death! which is the 2014 video of the year from the DEBUT album of the year 2014 * Nervosa “Victim of Yourself” which was unleashed on Planet Metal on Feb 28th 2014

************
*********************
*****************************

Here is the most original 1st known, biography of Fernanada Lira this information is courtesy of there 1st official website before the current website went live. A couple of months ago (get exact date — editor)

Known and knowledgeable of the underground metal scene, Fernanda Lira upsets any stereotype that girls do not know how to play heavy music.Merging energy and aggression in her playing and behave onstage, the bassist and vocalist come for several years, advocating and raising the flag of the passion for metal.
Fernanda discovered her love for music at an early age, being influenced playing bass at age 13 by her father, also a bassist, and also by her biggest idol from childhood: Steve Harris, the band Iron Maiden.
Self-taught, never attended classes to develop their technical and footprint, always with his ear and dedication as best allies in this musical journey. Still, her ability is always well recognized in their work and in their compositions stand down because “the play dramatically. She is very creative and more interesting is precisely the fact of his instrument always be quite audible” commented Pierre Cortes, reviewer of the most trusted heavy metal in Latin America, Whiplash.Net.
Eliminating the use of blades and investing in ridings with fingers, Fernanda does not hide her biggest influences: besides the aforementioned, she also admires and has always been inspired by bassists such as Geezer Butler, Steve Di Giorgio, Geddy Lee, Ron Royce and Markus Grosskopf , which is reflected in its bold attempts to take down the function of only ‘mark’ the rhythm of the songs.
Have her vocal inspirations are completely different. Preferred since childhood to learn to sing and imitate their idols like Tarja Turunen metal, Geoff Tate and Michael Kiske. However, after experiencing more torn backing vocals on one of her previous bands, began to migrate to a different style of singing, relying mostly on large vocalists and bassists idols like Tom Araya, Slayer, and Schmier, Destruction of thrash legend.
Fernanda started her career in bands at age 15, in a group that blended with traditional melodic metal. Soon after, she formed along a former bandmate to Hellarise, with whom she recorded her first audio record, which got some success: thanks to the record where his low “draws attention so incredible” (Christiano KODA, Whiplash. Net), this former band was featured in an issue of the magazine Roadie Crew and was selected to the São Paulo round the Wacken Metal Battle.
For reasons of personal and musical differences divergence, Fernanda was removed from this former band, for no more want to follow the cliché that is emerging among bands with female component, which is to practice the musical lines similar to the vocalist Angela Gossow of Arch and her cronies Enemy, for example.
Judging by his way of composing, Fernanda has always maintained a greater preference to the style that provides fast thrash metal, and after some time away from the scene, the bassist went to look for new members to form a new group of metal, this time making a sound purely thrash, and preferably, old school. After several attempts, she was invited to participate in Nervosa, where she took both posts bassist and vocalist, and who is conquering its space again on the scene, closing major partnerships and sponsorships for the band, and playing through several states in Brazil.
Currently, Fernanda Lira has been improving their old techniques and developing new, especially as regards the vocal lines and compositions with Nervosa, and works in the area of music journalism, as a reporter and photographer from radio Heavy Nation of UOL, and columnist for the site Whiplash.Net.
*********************
*********
***********
************************
Here is Nervosa thrash biography page @ The Flaming Arts Management and Booking Agency

NERVOSA thrash

All female Brazilian thrash metal trio from São Paulo. The music composed by the girls in NERVOSA has strong influences on thrash metal, mixed with original and personal elements inserted by each of the band members on the songs.

Even joining, in the past, bands from different styles, like punk, hardcore, death metal and crossover, all band members see in NERVOSA’s music one common passion: thrash metal. With strong influences from classic old school bands, such as Slayer, Sepultura, Exodus, Ratos de Porão, Pantera, Napalm Death, the girls try to pick up what’s best on this old school heavy music, like the 80′s style, so loved among the metalheads.

The band started in february 2010, Prika Amaral and Fernanda Terra knew each other and had the same will to play thrash metal. After a long time looking for bassplayers and singers, many rehearsals, and 4 composed songs, it was only in July 2011 that the girls got to know Fernanda Lira that immediately joined the band, assuming both positions singer and bassplayer in the band. To complete the team, Karen, from Curitiba, Brazil and band’s old friend, does her first rehearsal in august 2011.
But, in the beginning of 2012, guitarist Karen Ramos, due to personal reasons related to her distance from the city of São Paulo, opted to leave the band and move on with other projects.
The other band members, then, decided to go ahead with the band as a power trio, discarding the possibility of another guitarplayer entering the band.

In March 2012, the band launched their first video clip for the song ‘masked Betrayer’, that reached the incredible mark of 20 thousand views in only a week, what led them to receive an honorable mention from YouTube, in the post of 17th most viewed artists video and 55th most viewed in the month of March.

Thanks to the notoriety conquered through their hardwork, NERVOSA, in the following months, got two huge achievements.
The first one was the deal with american manager Jeff Keller, who also represent great band like Destruction and Hirax.
The other big news was the band inking a deal with the Austrian record label Napalm Records, which has in their roster names like Grave Digger, Hate, tiamat, Huntress, among others.
The first band’s recording, a 3-track demo, was released in Brasil in CD, independently by the name ’2012′ in august, and worldwide by Napalm Records, in turquoise, and later, purple vinyl version and by Nuclear Blast in clear, and later, red vinyl version, both entitled as ‘Time of Death’, which coverart was designed by artist Andrei Bouzikov, who has already worked with many bands previously, such as Municipal Waste.
In october, drummer Fernanda Terra leaves the band due to personal reasons and incompatibility of ideas.

Nervosa ends the year of 2012 with a very positive balance with almost 50 shows made around Brazil, and, among them, playing with bands like Exodus, Raven, Grave, Samael (in the festival Roça N Roll, where the played thanks to a contest the won, which took them to the finals and, after, to play in the festival), Exumer, Artillery.
2013 already starts with full steam for the band: they already played along with Destruction in São Paulo, started a mini tour in the North and Northeast of Brazil, in places they had never played before, signed with the European booking agency The Flaming Arts for a future tour around that continent, and started the recordings for the first full-length which must be out in the middle of this year.

************************
**********

Fernanda Lira-o-garphy

Done in a timeline sequence

2008 * HellGard * Rise of a Kingdom * Bass and BACKING VOCALS ** DEMO

2010 * HellArise * Human Disgrace * Bass* DEMO
August * 2010

2012  Nervosa * Masked Betrayer * Bass/ Vocal ** OFFICIAL VIDEO
March*1*2012
Metal Works Audio Visual Edition
Metal Works Audiovisual
11 4107-0888
metalworksaudiovisual@gmail.com
contato@avworks.com.br

2012 * Nerovsa * 2012 DEMO original Cover
August*16*2012
Private Pressing * Self Released

2012 * Nervosa * Time of Death ** Bass/Vocals
LP 1st Pressing ** (re-edition of 2012 demo different artwork, new title)
1st 150 Limited Turquoise Vinyl and 2nd Limited 150 Clear Vinyl
Septmeber*21*2012

2012 * Nervosa * Masked Betrayer * Bass/ Vocals **Official Video
Oct 5, 2012
Napalm Records

2013 * Nervosa * Time of Death ** Bass/Vocals
LP 2nd Pressing **(re-edition of 2012 demo different artwork and, new title)
1st 150 LIMITED Red Vinyl and 2nd Limited Purple Vinyl
March * 2013

2013 * FANTTASMA * Anothoer Sleepless Night ** CD **
Guest Vocalist on tacks 3 and 5, Fernanda Lira provides cleans vocals
March*11*2013

2013 * Torture Squad * Esquadrão de Tortura
November*15*2013

2014 * Nervosa* Death! * Bass/ Vocals * Official Video
Feb*17*2014
Napalm Records

2014 * Nervosa * Victim of Yourself * Bass/Vocals ** CD
Feb*28*2014
1st European Pressing Napalm Records Austria

2014 * Nervosa * Victim of Yourself * Bass/Vocals ** CD
March*28*2014 1st USA Pressing Napalm Records Canada/USA
The European And USA * CD stickers are completely different for those who purchased this
On The First day it was released

2014 * Nervosa * Victim of Yourself * Bass/Vocals ** CD
March*20*2014 1st Japanese Pressing* Spritual Beast Japan

2014 * Nervosa * Victim of Yourself * Bass/ Vocals ** CD
March*30*2014 1st Brazil Pressing * Diehard Records Brazil

Fernanda Lira

Accomplishment / Achievements

Fernanda Lira is the ONLY  World Class Bassis/t Vocalist who is a KICK*ASS*METAL hall of fame member BEFORE a debut album was released. This is a historic first

Top 20 favorite artist of all time @ KICK*ASS*METAL

This is there official rating / ranking @ KICK*ASS*METAL

KICK*ASS*METAL hall of fame Member nominated as a World Class Vocalist in the styles of 1980’s metal and style of 1990’s metal. Traditional Metal and True Metal what the mainstream calls EXTREME METAL or Dark Metal

March 1st 2012

For the Video of the year 2012

Nervosa “Masked Betrayer”

Video of year winners 2012, 2014

Nervosa * Masked Betrayer  * 2012

Nervosa * Death! 2014

Debut album of the year 2014

Nervosa * Victim of Yourself

TOP 10 album of the year 2014 * Ingternational

Categories. Traditional, Thrash, MOST authentic

*Worlds Greatest thrash band winners – International

2011, 2012, 2013, 2014

*Fernanada Lira Joined

Nervosa in July, 2011

Nervosa thrash, as a power trio.

This is when Nervosa was a quartet in 2011 * Fernanda Lira Joins Nervosa in July 2011

FOR THE DECADE 2010. THERE ARE TWO WORLD CLASS VOCALIST IN THE THRASH AND DEATH METAL STYLE THAT ARE LIGHTYEARS AHEAD OF THERE PEERS

THESE ARTIST IN THIS DECADE ARE 2010

ARE

# 1 RATED IN THE DEATH METAL STYLE FOR THE DECADE 2010 IS Mallika Sundramurthy of Abnormality fame

and

# 1 RATED NEWCOMER IN THE THRASH METAL STYLE FOR THE DECADE 2010 IS Fernanda Lira of NERVOSA fame

Nervosa_Kam_file_1555324_591802120868236_2011550031_n

Below photo caption * March 6 * 2013
“Raise your fist if you’re anxious to listen to our new album, which is being recorded right now!!!

*********

fernandalirakickassemetalmarch2012hallofffamemember984637534r3q498jpg

thenervosaheavymetgalmixeddrinkkaugust232016milwakee9879766345234

fernadaliradrinkingadrinkcalledthenervsoainventedinmilwakee9897685352

 

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

 

 

nervosaagonytop100heavymetalalblumofalltime2016albumoftheyear9987987987798554a113232112

This list is just a snap shot in heavy metal history from July 1983 and Todays Date is March 11th, 2016.

 

Since I have started as a HEAVY METAL fan in 1978, there has never been bad year in heavy metal of the beloved 1980’s METAL STYLE, I started out with NWOBHM day 1 and Power Metal day 1 and Thrash Metal day 1 and Death metal day 1 and Black Metal day 1. So since being there from the start, every year there is top 10 thrash metal albums with 1983-1991 being the Golden Age of THE THRASH MEAL Age. With The True Metal the 1980’s Metal being in its 36th year, a TOP 10 list is not that hard to do, I just look on my desk and altar of metal, aka my stereo and the which CD’s and Vinyl albums are on the table, these albums are always being played loud und proud, and I OWN 30 thirty copies of most of these albums since they are the most timeless, and easily surviving the test of time during heavy metal’s death metal age, from 1990- infinity, death metal will never go out of style, because the top 100 artist never have been tempted to sellout, death metal gets better year in and year out, since I started with the Genre in 1983.

We selected our top 700 true metal albums of all-time, and just looked at the THRASH METAL GENRE, and realized as always our favorites are also the GREASTEST OF ALL-TIME. 700 albums — 700 voters, one KICK*ASS*METAL article, just in time for 2 of the greatest releases of 2016 Sindrome “Resurrections The Complete Collection” and Nervosa “Agony”.

This list is the Greatest thrash metal albums of all-time, and do not confuse that with  a the “first 10” Thrash Metal Releases, there was a lot of growth in the thrash metal field, year after year….!!!!

 

 

TOP 10 THRASH METAL ALBUMS OF ALL-TIME

 

# 1 Ranking for GREATEST 20TH Century Thrash Metal Exodus (San Francisco, California)

#1 Ranking for GREATEST 21ST Century Thrash Metal Nervosa (

 

Annhilator “Alice In Hell”

exodusbondedbybloodtop100heavymetal

exodusworldsgreatestthrashmetalbayarea1985heavymetalhalloffame98597544323

exodusbondedbybalofftop100heavymetalalbumsofalltime98759784532

exodusalessoninviolencetop100heavymetalalbumsofalltime

Exodus “Bonded By Blood”

 

Forbidden “Forbidden Evil”

 

Onslaught “The Force”

 

Metallica “Kill “Em All” * Megaforce/Important Records

metallicakillemalltop100heavymetalalltime99998989877

metallicakillemalltop100heavymetalalltime9987878

metallica_killemall_974867334232

 

Nervosa “Vicitm of Yourself”

nervosatop100heavymetallegendsofalltime879789968564a2342323123

nervosarulesplanetmetal_978585634964981182_n

 

nervosakickassmetalworldsgreatestthrashmetalbandofthe21stcentury99999999998759665743

*****the photo above is the press photo today 3/11/2016 for the upcoming TIMELESS MASTERPIECE Nerovsa “Agony” when I do this list again I have to make the hard choice between “Victim of Yourself” and “Agony”. It will come down to which album has the more crunching and effective RAZOR sharp RIFFS, with METALLIC EVOCATION stamped all-over the material******

Make NO Mistake Nervosa is THE REAL DEAL, Retro-METAL nothing, just forward metal thinking, with sharp effective RIFFS all the way !!!!!!!!!

 

nervosakickassmetal2016heavymetalalbumoftheyear98879675643234211223446

Sabbat “History of A Time To Come”

 

Slayer “Hell Awaits”

 

Seputlura “Beneath The Remains”

 

sepulturabeneahtheremainstop100heavymetalalbumofalltime99998878787a1989

 

Sindrome “Resurrection”

 

 

sindromeresurrectiontop100heavymetalalbumsofalltime98755654344132234545

 

pitchuferraz_kickassmetal_nervosalegend_987987_9999

photo credit above JJ Besse….photo is courtesy of JJ Besse !!!!!

 

Baqueta Spanking Linha Signature Pitchu Ferraz (Padrão 5A/5B) Banda de Thrash Metal Nervosa

Cód.: 004874
pitchuferraz_nervosaworldclassdrummmer_987987_9998
DDD 11) 2446-0995 / (Tim) 9-5378-8000 / (Vivo) 9-7461-8494 / (Oi) 9-6874-3438 / (Claro) 9-6621-1670 (Seg-Sex 9h às 18h) / vendas@bateraclube.com.br
pitchuferraz_kickassmetal_nervosalegend_987987_9999

10620265_734827623232351_3480152283717759195_o

Fernanda Lira * World-Class Vocalist & World-Class Bassist

10408520_734828329898947_1293490584048797938_n

Prika Amaral * World-Class Metal Guitarist and World-Class Background Vocalist

1272397_734826616565785_361712918841447172_o

Pitchu Ferraz *World-Class Drummer

kick_ass_metal_nervsoa_98765432_1901577_608404329208015_878812817_n

nervosa_kam_file__kam9_539232_619439734771141_1985217046_n

nervosa_kam_file_nervosa1982362_619439831437798_629108958_n

kam_file_nervosa_1175474_619439841437797_561048333_n

nervosa_kam_file_1465351_619439798104468_1374313443_n

nervosa_kam_file_1525388_619439784771136_2028130789_n

nervosa_kam_file_1150286_619439738104474_2079333222_n

NERVOSA * VICTIM OF YOURSELF 2014

DEBUT ALBUM OF THE YEAR WINNER

&

HEAVY METAL ALBUM OF THE YEAR WINNER

2014

 

nervosa_kam_file_10392385_737842639597516_3258138959404015266_n

kick_ass_metal_RULES-NERVOSA_RULES_1531855_415181481969274_188441262536555540_n

 

kickasstal_2014_77130_598114493570332_1932193783_n

 

Nervosa (Brazil)

Victim of Yourself

Napalm Records

KICK*ASS*METAL rating

100 out of 100 blood dripping skulls

TIMELESS MASTERPIECE

PERFECT THRASH METAL MAYHEM

Cat # NRP 520

EA

8 19224 01732 5

 

The Metal hero’s on the 2014

debut album of the year 2014. Nervosa also won the 2014 heavy metal ALBUM OF THE YEAR.

In 2 months KICK*ASS*METAL, & the international true metal community will be celebrating the 1 year anniversary celebration of Nervosa’s “Victim of Yourself”.

 

Nervosa “Victim of Yourself ” is not only the debut album of the year 2014, and Heavy Metal album of the year 2014. It is a metal klassiker that has a timelessness aspect to the songwriting.

Nervosa has influences such as Exodus, Slayer, Sepultura, RDP, Pantera.

Nervsoa has their own sound and their own style.

Fernanda Lira is a World-Class Vocalist and a World- Class Bassist.

1912295_542910359149797_1462914189_n

It does not matter if you are a traditional metal musician / fanatic or an extreme metal musician / fanatic.

This is the band to beat in the future, in terms of originality and authenticity.

The bar has been risen, good luck…

Nervosa won the debut album of the year & Heavy Metal album of the year on authenticity, alone.

Authenticity, plus the bands one-of-a-kind sound /style…aka originality.

Put, Nervosa in the best of the best of metal artist not of the 21st century but of all-time, in the history of true heavy metal. True metal to me, means what it did when I started with heavy metal in the summer of 1980. The Motorhead family of bands.

 

As a life long fan of guitar based heavy metal, Prika Amaral is one-of-my-favorite guitarist of all-time. Currently rated/ ranked #20 all-time in the history of heavy metal.

prika amaral_98765432_568253883223060_1130738908_kam

 

Nervosa “Victim of Yourself” is always a everyday listen on my CD player, and will make my monthly playlist. For the next 36 years…I am going on my 36th year as a metal maniac / metal fanatic.

 

I already own 16 official factory pressed copies of Nervosa “Victim of Yourself”. Since this album to is in the same daily playlist rotation of albums. IMMORTALS OF METAL, such as Metallica’s “Kill ’em All”, Exodus “Bonded By Blood”, Sepultura “Beneath The Remains”, Deicide “Legion”, Mercyful Fate “Melissa” & Slayer “Show No Mercy”. I plan on owning 30 copies of this CD in my PERSONAL COLLECTION and the KICK*ASS*METAL’s heavy metal hall of fame collection @ all-times.

Any so-called “metal” publication, who rated this album under 100 out of 100…they ripped you off.

Add Nervosa “Victim of Yourself” “to your record collection ASAP, ( i plan on spending a months earnings 3000$USD on Nervosa merchandise, circa 2015…etc… ). The same amount i save for Christmas. which is 343 days a way by the way……

Luckily for me i was covering the Crest of Darkness and Cradle of Filth stories back in March 2012, and the legendary Video Nervosa “Masked Betrayer” caught a huge buzz. I have been a Nervosa thrash metal addict ever since.

kam_2012_hof_987654321

 

Nervosa has in its ranks a World-Class Drummer in Pitchu Ferraz.

kick_ass_metalpitchu_ferraz_2013_98765432_680116332036814_4185722326752429415_kam

Nervosa is one of my favorite power trio’s of all-time.

Nervosa is a power trio that plays with POWER.

POWER, TALENT AND CONVICTION.

 

Nervosa rules Planet Metal…!!!

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

TOP 10 albums of 2014 l@@ks something like this

nervosa_kam_file_10478081_413323345488421_95574355672641548_n

NERVOSA * VICTIM OF YOURSELF

KICK*ASS*METAL’S 34TH ANNUAL DEBUT ALBUM OF THE YEAR WINNER 2014

NERVOSA * VICTIM OF YOURSELF

KICK*ASS*METAL’S 2014 HEAVY METAL ALBUM OF THE YEAR WINNER *INTERNATIONAL.

 

The last time a all-female heavy metal band won the album of the year and debut album, was in 2005. That was Crucified Barbara with the mind-blowing and jaw dropping “IN DISTORTION WE TRUST”

nervosa_kam_file_1535451_598956540152794_414184435_n

NERVOSA’s Prika Amaral (left) and Fernada Lira (right). Pedal to the Metal. They are the METAL and those are the pedals from ED’S MOD SHOP !!!!!!!!!!!

THRASH AND RAGE AND BANG YOUR HEAD UNTIL IT L@@KS LIKE A BLOODY PANCAKE…IF NOSEBLEED KEEP GOING ITS NERVOSA FOR CRYING OUT LOUDS !!!!!!!!!!!!!!