Archives for posts with tag: Nervosa

Abattoir * Vicious Attack

Accept * Restless and Wild

Acid * Acid

ACID * Manic

ACID * LIVE IN BELGIUM

 

Agent Steel- Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis- Screams and Whispers.

ANGEL DUST- INTO THE DARK PAST

Angel Witch * Angel Witch

ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland

ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS

Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECORDS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…

Anvil- Metal on Metal

ANVIL- FORGED IN FIRE

Anvil- Live in concert

Anvil-Worth the weight

ANVIL CHORUS * THOUGHT CRIMES

Anvil Chorus * The Killing Sun

Artillery * Fear Of Tomorrow

ARTILLERY * TERROR SQUAD

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

Attacker-Battle at Helms Deep

Attacker-Second Coming

Attacker * Soul Taker

Attacker * The Unknown

Attacker * Giants of Cannan

Attacker * Sins of the World

AVATARIUM * AVATARIUM

AVATARIUM * GIRL WITH THE RAVEN MASK

AVATARIUM * HURRICANES AND HALOS

BATHROY * BATHORY

Bathory * The Return…

Benedectium “Uncreation”

BENEDICTUM “SEASON OF TRAGEDY”

Benediticum “Dominion”

Benedticum “Obey”

Bitch * Damnation Alley

Bitch- Be My Slave

Black Death * Black Death * Auburn Records

Black Sabbath- Mob Rules

BLIND ILLUSION- THE SANE ASYLUM

Bloodlust – Guilty As Sin

BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS

BLITZKRIEG * A TIME OF CHANGES

CACOPHONY- SPEED METAL SYMPHONY

Cage- Astrology

Cauchemar “Tenebrario”

Cauchemar “Chapelle ardente”

Candlemass-Nightfall

Carnivore * Carnivore

Cathedral- Supernatural Birth Machine

CELTIC FROST- MORBID TALES

Celtic Frost- Emperors Return

Celtic Frost- To Mega therion

CELTIC FROST- INTO THE PANDEMONIUM

CHASTAIN * MYSTERY OF ILLUSION

Chastain * Ruler of the Wasteland

Chastain * The 7th of Never

Chastain * The Voice of Cult

Chastain- For those who Dare

CHASTAIN- IN A OUTRAGE

CHASTAIN * WE BLEED METAL

Chastain * We Bleed Metal17

Christian Mistress “Agony & Opium”

Christian Mistress “Possession”

Christian Mistress “To Your Death”

COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE

COVEN * JINX

COVEN * Worship New Gods…Coven …aka Coven13

CIRITH UNGOL * FROST AND FIRE

CIRITH UNGOL * KING OF THE DEAD

Crimson Glory- Crimson Glory

CRYPTIC SLAUGHTER * CONVICTED

Crucified Barbara “In Distortion We Trust”

Crucified Barbara “”Til Death Do Us Party”

Crucified Barbara “The Midnight Chase”

Culprit- Guilty As Charged

CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld

Dark Angel * We Have Arrived

DARK ANGEL * DARKNESS DESCENDS

DARK ANGEL * LEAVE SCARS

DEF DEALER * KEEPER OF THE FLAME

DEF DEALER * JOURNEY INTO FEAR

DEATH- SCREAM BLOODY GORE

DEATH * LEPORSY

DEATH- SPIRITUAL HEALING

DEATH- HUMAN

DEATH-INDIVIDUAL THOUGH PATTERNS

DEATH * Symbolic

Death Angel- The Ultra-Violence

DEATH ANGEL- ACT III

DEATH PENALTY “DEATH PENALTY82”

Death Strike-Fuckin’ Death

Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe

Ded Engine * Hot Shot

Ded Engine * Hold A Grudge

Deep Switch- Nine inches of God

Demona * Metal Through Time

Demona * Speak With The Devil

DESTRUCTION- INFERNAL OVERKILL

Détente “Recognize No Authority”

Détente “Decline”

Diamond Head * Diamond Head…1980 …aka Lightning to the Nations

Diamond Head- Lightning to the Nations

Diamond Head- Behold the Beginning

Discharge * Hear Nothing, See Nothing, Say Nothing

Dream Death- Journey Into Mystery

DOCTOR BUTCHER- DOCTOR BUTCHER

Doro * Force Majure

Doro * Doro

Doro “Warrior Soul”

Doro “Fear No Evil”

DORO “25 YEARS….AND STILL GOING STRONG”

DORO “RAISE YOUR FIST”

DORO * STRONG AND PROUD”

EDGE OF PARADISE * MASK

EDGE OF PARADISE * IMMORTAL WALTZ

EDGE OF PARADISE * ALIVE

ELECRIC WIZARD “BLACK MASS”

EXCITER- HEAVY METAL MANIAC

Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS

EXCITCER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

Exhorder- Slaughter in the Vatican

EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE

EXODUS- BONDED BY BLOOD

EXODUS- PLEASURES OF THE FLESH

EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)

EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)

Exorcist * Nightmare Theatre

EXUMER * POSSESSED BY FIRE

EXUMER * RISING FROM THE SEA

FATES WARNING * NIGHT ON BROKEN

Fear of God * Within The Veil

FIRESTRIKE “LION AND TIGER”

FORBIDDEN- FORBIDDEN EVIL

FORBIDDEN * TWISTED INTO FORM

THE GATHERING * MANDYLION

THE GATHERING * NIGHTTIME BIRDS

GIRLSCHOOL “HIT AND RUN….REVISITED”

GIRLSCHOOL “GUILTY AS SIN”

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS

GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS

THE GREAT KAT- WORSHIP ME OR DIE!

THE GREAT KAT- BEETHOVEN ON SPEED

THE GREAT KAT- BEETHOVEN SHREDS

Griffin- Flight of the Griffin

Hawaii- One Nation Underground

HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK

HALLOWEEN- DON’T METAL WITH EVIL

HALLOWEEN – No One Gets Out! 

Halloween – No One Gets Out! Molten Metal Records Version w/ The Vicious Demo

Hell- Hell (1982)…1982-1986 Compilation that come with 2 disc version of 2011 CD

H-Bomb- Attaque

HEATHEN- BREAKING THE SILENCE

HEATHEN- VICTIMS OF DECEPTION

HEATHEN-RECOVERED

Hellion * The Black Book

Hellion * To Hellion and Back

HIRAX- RAGING VIOLENCE

HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD

HOLOCAUST- THE NIGHTCOMERS

Holy Moses * The New Machine of Lichtenstien

Holy Moses * Strength, Will, Power, Passion

Holy Moses * In the Power of Now

Imagika * Imagika

Imagika * Worship

IMAGIKA * And So it Burns

Infernal Majesty * None Shall Defy

Insanity- Death after Death

Insatia “Asylum Denied”

Insatia”Phoenix Aflame”

IRON MAIDEN- IRON MAIDEN

IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games

JAG PANZER- AMPLE DESTRUCTION

Judas Priest * Killing Machine

Judas Priest * Hellbent for Leather * aka Killing Machine

JUDAS PREIST * UNLEASHED IN THE EAST

Judas Priest- British Steel

Judas Priest- Painkiller

Kobra and the Lotus “Kobra and the Lotus”

Kobra and the Lotus “High Priestess”

King Diamond-Fatal Portrait

King Diamond- Abigail

King Diamond- Them

Kreator- Endless Pain

Kreator – Pleasure to Kill

Lady Beast * Lady Beast

Lady Beast * Lady Beast II

Lady Beast *  Metal Immortal

Liege Lord- Master Control

LUCIFER “LUCIFER I

Macbre- Gloom

Malediction- Condamnes

Manowar * Battle Hymns

MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS

MANOWAR * HAIL TO ENGLAND

MASSACRE “FROM BEYOND”

MASSACRE “BACK FROM BEYOND”

MASTER- MASTER

MASTER- 1985 ALBUM UNRELEASED

Mastercastle “Last Desire”

MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album

Medieval- ALL KNOBS TO THE RIGHT

MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP

MEDIEVAL- MEDIEVAL KILLS

MEDIEVAL * CASSETTE ALBUM/ ALL KNOBS TO THE RIGHT — DOUBLE PLAY CLASSIC

THE MENTORS * YOU AXED FOR IT

MERCYFUL FATE- 1982 EP

MERCYFUL FATE- MELISSA

MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS

MERCYFUL FATE- THE BEGINNING

MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS

METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP

METALLICA- KILL EM ALL * MEGAFORCE RECORDS

METALLICA – RIDE THE LIGHTNING * MEGAFORCE RECORDS

Morbid Angel- ABOMINATIONS OF DESOLATION

MORBID ANGEL- ALTARS OF MADNESS

MORBID ANGEL BLESSED ARE THE SICK

MORBID ANGEL * COVENANT

MORDBID ANGEL * DOMINATION

MORBID ANGEL* ENTANGLED IN CHAOS

Motorhead- Ace of Spades

MOTORHEAD- NO SLEEP TIL HAMMERSMITH

Motorhead * Iron Fist

Motorhead * Another Perfect Day

Motorhead * No Remorse

Motorhead * Orgasmatron

Mystery Blue “Hell and Fury”

Nasty Savage- Nasty Savage

NASTY SAVAGE- INDULGENCE

Nervosa “2012”

Nervosa  * TIME OF DEATH

Nervosa  *VICTIM OF YOURSELF

Nervosa “Agony”

Nightmare * Astral Deliverance

Nightwish “Once”

Nightwish “Endless Forms Most Beautiful”

THE OATH “THE OATH”

OBITUARY * SLOWLY WE ROT

OBITUARY * Cause of Death

Obilevon * From this Day Forward

Obliveon * Nemesis

ONSLAUGHT- THE FORCE

Original Sin * Sin Will Find You Out

OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS

OZ- Fire in the Brain

OZ – III Warning

Ozzy Osbourne- Blizzard of Ozz

Ozzy Osbourne-Diary of a Madman

Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette

Pagan Altar- Pagan Altar Volume 1

PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1

PILE DRIVER- METAL INQUISITION

PILE DRIVER * STAY UGLY

Pentagram- Pentagram

Pentagram- Day of Reckoning

Pentagram * Relentless 1985 debut Retitled

Pentagram- Be forewarned

POSSESSED- SEVEN CHURCHES

 

RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS

RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS

RAZOR- EXECUTIONERS SONG

RAZOR- EVIL INVADERS

REPULSION * SLAUGHTER OF THE INNOCENT

REPULSION – HORRIFIED

Resistance * ” Resistance”

Riot- Fire Down Under

Riot- Thunder Steel

Riot- Privilege of Power

RUSH * A FARWELL TO KINGS

RUSH * PEMANENT WAVES

RUSH- MOVING PICTURES

RUSH * EXIT…STAGE LEFT

RUSH- SIGNALS

RUSH- GRACE UNDER PRESSURE

RUSH- POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * PRESTO

RUSH * CHRONICLES

RUSH * TEST FOR ECHO

RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME

SABBAT ( NIPPON) * ENVENOM

SABBAT ( NIPPON) * EVOKE

SABBAT ( NIPPON) * DISEMBODY

 

SADUS * A VISION OF MISERY

Satan “Into the Fire”

SATAN “COURT IN THE ACT”

Satan “Suspended Sentence”

SATAN * LIVE IN THE ACT

Satan * Live Sentence”

Satan “Trail By Fire….”

Satan “Atom by Atom”

SAVAGE MASTER “Mask of Evil”

SAVATAGE * Sirens

SAVATAGE * The Dungeons are Calling

SACRIFICE- Torment in Fire

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLIDERS OF MISFORTUNE

SACRIFICE * APOCALYPSE INSIDE

SCORPIONS * TAKEN BY FORCE

Sentinel Beast “DEPTHS OF DEATH”

SENTINEL BEAST “UP FROM THE ASHES”

SEPULTURA- BENEATH THE REMAINS

Skullview- Kings of the Universe

Sindrome- Sindrome (2 demos on CD)

SINDROME “RESURECTION….”

Sign of the Jackal *  Mark of the Beast

 

SLAUGHTER- STRAPPADO

SLAUTER XSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER- SHOW NO MERCY

SLAYER- HAUNTING THE CHAPEL

SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS

Slayer- Reign in Blood

SODOM * IN THE SIGN OF EVIL

SODOM * OBSESSED BY CRUELTY

STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades

Tank- Power of the Hunter

TANK- THIS MEANS WAR

TERRORIZER-WORLD DOWNFALL

Testament- The Legacy

 

TROUBLE- PSALMS 9

TROUBLE * THE SKULL

TROUBLE * RUN TO THE LIGHT

TYGERS OF PAN TANG- WILD CAT

Tygers of Pan Tang- Spell Bound

Tyranex * Extermination Has Begun

Tyranex * Unable to Tame

TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent

Unseen Terror- Human Error

Vainglory * Vainglory

Venom- Welcome to Hell

Venom- Black Metal

Venom * At War with Satan

VICIOUS RUMORS * Soldiers of the Night

VICIOUS RUMORS * Digital Dictator

VIO-LENCE * ETERNAL NIGHTMARE

Voi Vod- War and Pain

Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?

Warfare * Pure Filth

WARFARE-METAL ANARCHY

Warfare * Mayhem Fucking Mayhem

Warlock * Burning The Witches

Warlock * Hellbound

Warlock * True As Steel

WARLOCK * TRIMPH AND AGONY”

Warlord-Deliver Us

Warlord * And The Cannons Of Destruction Have Begun

Warlord * Thy Kingdom Come * 1st EP and LP on CD

Warhead * Speedy Way

WARHEAD- THE DAY AFTER

Warning- Aftermath

WATCHTOWER- ENERGETIC DISASSEMBLY

Watchtower * Control and Resistance

WITCHCROSS- FIT FOR FIGHT

WITCHFINDER GENERAL- DEATH PENALTY

WITCHFINDER GENERAL- FRIENDS OF HELL

WildeStarr “Arrival”

WildeStarr “A Tell Tale Heart”

Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

 

 

 

 

 

 

 

 

Abattoir * Vicious Attack…Accept * Restless and Wild…Acid * Acid…ACID * Manic…ACID LIVE IN BELGIUM ’84Agent Steel- Skeptics Apocalypse…Agent Steel * Mad Locust Rising…Anacrusis- Screams and Whispers….ANGEL DUST- INTO THE DARK PAST…Angel Witch * Angel Witch…ANNIHILATOR * ALICE IN HELL…Annihilator * Never, Neverland…ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS…Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS…Anthrax * Spreading the Disease … features songs written by Neil Turbin……Anvil- Metal on Metal…ANVIL- FORGED IN FIRE…Anvil- Live in concert…Anvil-Worth the weight…ANVIL CHORUS * THOUGHT CRIMES…Anvil Chorus * The Killing Sun…Artillery * Fear Of Tomorrow…ARTILLERY * TERROR SQUAD…ARTILLERY * By Inheritanc…ATHEIST- PIECE OF TIME…ATHEIST- UNQUESTIONABLE PRESENCE…Attacker-Battle at Helms Deep…Attacker-Second Coming…BATHROY * BATHORY…Bathory * The Return….Bitch * Damnation Alley…Bitch- Be My Slave…Black Death * Black Death * Auburn Records…Black Sabbath- Mob Rules…BLIND ILLUSION- THE SANE ASYLUM…Bloodlust – Guilty As Sin…BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS…BLITZKRIEG * A TIME OF CHANGES…CACOPHONY- SPEED METAL SYMPHONY…Cage- Astrology…Candlemass-Nightfall…Carnivore * Carnivore…Cathedral- Supernatural Birth Machine…CELTIC FROST- MORBID TALES…Celtic Frost- Emperors Return…Celtic Frost- To Mega therion…CELTIC FROST- INTO THE PANDEMONIUM…Chastain * Mystery of Illusion…Chastain * Ruler of the Wasteland…Chastain * The 7th of Never…Chastain * The Voice of Cult…Chastain- For those who Dare…CHASTAIN- IN A OUTRAGE…CHASTAIN * WE BLEED METAL …Chastain * We Bleed Metal17…COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE…COVEN * Worship New Gods…Coven …aka Coven13…CIRITH UNGOL * FROST AND FIRE…CIRITH UNGOL * KING OF THE DEAD….Crimson Glory- Crimson Glory…CRYPTIC SLAUGHTER * CONVICTECrucified Barbara “In Distortion We Trust”…Culprit- Guilty As Charged….CYNIC * FOCUS…Dark Age- Dark Age 1984 Gnarly Records/ Greenworld…Dark Angel * We Have Arrived…DARK ANGEL * DARKNESS DESCENDS…DARK ANGEL * LEAVE SCARS…DEF DEALER * KEEPER OF THE FLAME…DEF DEALER * JOURNEY INTO FEAR…DEATH- SCREAM BLOODY GORE…DEATH * LEPORSY…DEATH- SPIRITUAL HEALING…DEATH- HUMAN…DEATH-INDIVIDUAL THOUGH PATTERNS…DEATH * Symbolic…Death Angel- The Ultra-Violence…DEATH ANGEL- ACT III…Death Strike-Fuckin’ Death…Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe…Ded Engine * Hot Shot…Ded Engine * Hold A Grudge…Deep Switch- Nine inches of God…DESTRUCTION- INFERNAL OVERKILL…Diamond Head * Diamond Head…1980 …aka Lightning to the Nations…Diamond Head- Lightning to the Nations…Diamond Head- Behold the Beginning…Discharge * Hear Nothing, See Nothing, Say Nothing…Dream Death- Journey Into Mystery…DOCTOR BUTCHER- DOCTOR BUTCHER…EXCITER- HEAVY METAL MANIAC…Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS…EXCITER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS…Exhorder- Slaughter in the Vatican…EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE…EXODUS- BONDED BY BLOOD……EXODUS- PLEASURES OF THE FLESH…EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)…EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)Exorcist * Nightmare TheatreEXUMER * POSSESSED BY FIREFATES WARNING * NIGHT ON BROKENFear of God * Within The VeilFORBIDDEN- FORBIDDEN EVILFORBIDDEN * TWISTED INTO FORM…GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS…GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS…THE GREAT KAT- WORSHIP ME OR DIE!…THE GREAT KAT- BEETHOVEN ON SPEED…THE GREAT KAT- BEETHOVEN SHREDS…Griffin- Flight of the Griffin…Hawaii- One Nation Underground…HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK…HALLOWEEN- DON’T METAL WITH EVIl…HALLOWEEN – No One Gets Out!…Halloween – No One Gets Out! Molten Metal Records Version featuring The Vicious Demo…Hell- Hell (1982)…1982-1986 Compilation that come with 2 disc version of 2011 CD…H-Bomb- Attaque…HEATHEN- BREAKING THE SILENCE…
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now
Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS
Iron Maiden- The Number of the Beast
Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill
Lady Beast * Lady Beast 
Lady Beast * Lady Beast II
Lady Beast *  Metal Immortal
Liege Lord- Master Control
Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
MASSACRE “FROM BEYOND”
MASSACRE “BACK FROM BEYOND”
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE
MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH
MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE
MERCYFUL FATE- INTO THE SHADOWS
METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron
Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE
Nervosa “2012”
Nervosa (Brazil) * TIME OF DEATH
Nervosa  *VICTIM OF YOURSELF
Nervosa “Agony”
Nightmare * Astral Deliverance
NME * UNHOLY DEATH
OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilevon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute
Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES
Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power
RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE
RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE
SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swalled in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO
SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SCORPIONS * TAKEN BY FORCE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SINDROME “RESURECTION….”
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD
SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS
SUICDIAL TENDENCIES * SUICIDAL TENDENCES
SYRIS * Unseen Forces
Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy
THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS
THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
The Rods* Wild Dogs
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.
UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error
Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR
Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
WARLOCK * TRIMPH AND AGONY”
Warlord-Deliver Us
Warlord * And The Cannons Of Destruction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon
 Zoser Mez- Vizer of Wasteland

 

 

 

Advertisements

nervosathesecondmostimportantdebutinheayvmetalhistoyr98979654

TOP 10

NERVOSA “AGONY”

NERVOSA “VICTIM OF YOURSELF”

NERVOSA “TIME OF DEATH”

NEROVSA “2012” 

FIRE STRIKE “LION AND TIGER”

SEPULTURA “BENEATH THE REMAINS”

KRISIUN “BLACK FORCE DOMAIN”

REBAELLIUN “BURN THE PROMISED LAND”

SODOMIZER “THE DEAD SHALL RISE TO KILL”

NEPHASTH “IMMORTAL UNHOLY TRIUMPH”

attomicametalgodsmetallegends97897897898

Attomica ” Disturbing The Noise’

autopsemetalgodsmetallegends9999897878

autopsemetalgodsmetallegends97878997897

Autopse “Fear and Death” Video/Single

CrucifixtionBR “Destroying The Fucking Disciples of Christ”

farscapemetalgodsmetasllegends999998798778967573

Farscape “Demon’s Massacre”

Fire Strike “Lion And Tiger”

aline-nunes-the_best_of_the_best_10343518_624809577601167_5403577561171468650_n

alinefirestrikemetallegend998978978978789

Indiscipline “In My Guts”

Indiscipline “Live at Toca”

Indiscipline “Sanguinea”

kickassmetal984786734562315indiscipline

miacoldheartkickassmetalheavymetalhalloffamemember2005withindisciplinecd998557765

indisciplinedebutalbumoftheyear2016heavymetallegends9789798657632

Krisiun “Black Force Domain”

Krisiun “Apocalyptic Revelation”

Krisiun “Conquerors of Armageddon”

Krisiun “Ageless Venomous”

Krisiun “Works of Carnage”

Krisiun “Bloodshed”

Krisiun “AssassiNation”

Krisiun “Southern Storm”

Krisiun “The Great Execution”

laceraatedandcarbonizedmetalgodsmetallegndsbrazil997878

Lacerated and Carbonized  “Homicidal Rapture”

Lacerated and Carbonized ” The Core of Disruption”

Lacerated and Carbonized “Narcohell”

leatherfacesmetalgodsmetallegnds999998978978

fernandaliraaugust232013kickassmetal9789778978978978

Leatherfaces “Leatherfaces”

Nervochoas  “To The Death”

nervosametalgods9897897978978967967867855675435345235423412342312

nervosalogometalgods978996775463523

Nervosa “2012”

Nervosa “Time of Death”

Nervosa “Victim of Yourself”

Nervosa “Agony”

nervosatop100heavymetalalbumofalltime99987978989784a20116

Nephasth “Immortal Unholy Triumph”

Nephasth “Conceived By Inhuman Blood”

Overdose “Circus of Death”

rabaelliunlogo789978978965643

Rabaelliun “Burn The Promised Land”

Rabaelliun “Burn The Promised Land/Bringer of War” 2on1 CD

Rabaelliun “Annihilation”

Rabaelliun “The Hell’s Decree”

sepultruametalgods91289787897878978789789

Sepultura ” Morbid Visions”

Sepultura “Beneath The Remains”

Sepultura “Arise”

sodomizermetalgodsbrazi9l789789978789789789789789789789789

Sodomizer “Tales of The Reaper”

Sodomizer “The Dead Shall Rise To Kill”

Sodomizer “Jesus Is Not Here to Day”

Sodomizer “Confessioni di un cannibal”

tortuesqaudmetalgodsmetallends98978797897897897

Torture Squad “Pandemonium”

Torture Squad “Death, Choas, and Torture Alive”

Torture Squad “Hellbound

Torture Squad “Æquilibrium”

Torture Squad  “Esquadrão de Tortura

FERNANDA LIRA — AUGUST 23RD, 2013

fernandaliraaugust232013kickassmetal9789778978978978

Torture Squad “Coup d’État Live”

Torture Squad “Return of Evil”

mayundeadpuertaskickassmetalmetalgodsmetallegnds987978978

Violator “Chemical Assault”

Vocifera “Evil Thoughts”

vociferakickassmetalmetalgodsmetallegends98789789789

 

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

kickassmetalplantmetalbrazilmetalrules98996774635442

 

 

 

 

surgikillsanguinaryrevelationm318206a989574541345

 

In 2016 there were 5 albums that left an indelible mark on my psyche as well as the history books of heavy metal, the deepest scares in the history books for all things KICK*ASS, were Abnormailty “Mechanizations to Omniscience”, Nervosa “Agony”, Surgikill “Sanguinary Revelations”, Darkness “The Gasoline Solution”, and Asphyx “Incoming Death”….and tons of others, 2016 was one of the best years in heavy metal, as a true fan of the genre since 1978…. There are top 10’s elsewhere please flip thorough the chapters. But all top 100 list are not perfect, as the 1980’s metal movement is in its 37th year. 1980-2017. This top 100 is WHAT ALBUMS HEAVY METAL HALL OF FAMES AND WHAT ALBUMS ALTARS FOR HEAVY METAL ARE BUILT AROUND

Abnormality “Contaminating The Hive Mind

Abnormality “Mechanizations To Omniscience”

Acheron “Rites of the Black Mass”

Asphyx  “Asphyx”

Bathory “Bathory”

Bathory “The Return….”

Bathory “Blood Fire Death”

Bloodreaping “Ingins Penumbra”

Carpathian Forest “FUCK YOU ALL !!!”

Carnage  “Dark Recollections”

Celtic Frost  “Morbid Tales”

Celtic Frost “Emperor’s Return”

Celtic Frost  “To Mega Therion”

Centurions Ghost “A Sign of the Times”

Cradle of Filth “Principle of Evil Made Flesh”

Crest of Darkness “The Ogress”

Crest of Darkness “Project Regeneration”

Crown of Thorns “Eternal Death”

Entomed “Left Hand Path”

Exumer “Possessed By Fire”

Death “Scream Bloodly Gore”

Decide “Deicide”

Deicide “Legion”

Dispiln “Antilife”

Gravehill “Rites of the Pentegram”

Impiety “Skullfucking Armageddon”

Impetigo “Horror of Zombies”

Incantation  “Onward to Golgotha”

Iperyt “Totalitarian Love Pulse”

Killaman “Killaman”

Kings-Evil “Deletion of Humanoise”

Krisiun “Black Force Domain”

Leviathan “The Tenth Sublevel of Suicide”

Massacra  “Final Holocaust”

Massacre “From Beyond”

Massacre “Back From Beyond”

Master ” Master”

Morpheus Descends  “Ritual of Infinity”

Morbid Angel  “Abominations of Desolation”

Morbid Angel “Altars of Madness”

Morbid Angel “Blessed are the Sick”

Morbid Angel “Covenant”

Mythos “Pain Amplifier”

Naglfar “Vittra”

Nervosa “2012”

Nervosa “Time Of Death”

Nerovsa “Victim of Yourself”

Nervosa “Agony”

Necromessiah “Antiklerical Terrorisk Death Squad”

Necrophobic -“The Nocturnal Silence”

Nightside “End of Christianity”

Nile “Amongst The Catacombs of the Nephren-Ka”

Nocturnal Breed “Agressor”

Nocturnal Breed “Fields of Rot”

Nocturnus “The Key”

Nocturnus “Thresholds”

Obituary  “Cause of Death”

Occult “Rage to Revenge

Occult “Elegy for the Weak”

Pessiminst “Blood For the Gods”

Possesed “Seven Chuches”

Rabaelliun “Burn the Promise Land”

Rabaelliun “Annihilation”

Ritual Carnage “The Highest Law”

Slaughter “Strappado”

Slayer “Show No Mercy”

Sinners Burn “Insanity Warmachine”

Sodomizer “The Dead Shall Rise”

Surgikill “Sanguinary Revelations

Suffocation – Effigy of the Forgotten

Surrender of Divinity “Oriental Hell Rhythmic”

Therion -“Of Darkness”

Therion “Beyond Sanctorum”

Tsjuder “Antiliv”

Urgeheal  “Goatcraft Torment”

Warfect “Exoneration Denied”

Winters of Sin “Violence Reigns Supreme”

Vader  “The Ultimate Incantation”

Vader “Litany”

Zyklon “World of Worms”

Zyklon “Aeon”

surgikillsanguinaryrevelationm318206a989574541345

 

crestofdarknesskickassmetalheavymetalhallofamelegend9879789

darknessthegasolinesolutionkickassmetalheavymetalhallofamealbum987789789789789

nervosatop100heavymetalalbumofalltime99987978989784a20116

 

iperypttotalitarian87978978656543

impietykickassmetal8979898765665a12323213

krisiumblackfrocedomain897898978986

sepulturabeneahtheremainstop100heavymetalalbumofalltime99998878787a1989

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

nervosaheavymetalgodslegends98797896772341413431242323423

deicidelegionkickassmetal9999789879798

 

destuctionkickassmetalheavymetalhallofamealbum989786754353pg

therionofdarkness-kickassmetal98979765745

slayershownomercytop100albumofalltime9898777

metallica_killem_all_9786476455623462353523453

metallica_killemall_974867334232

 

Timeline from

Abnormality “Containing the Mind Hive” to Slayer “Show No Mercy”

TOP 100 DEATH METAL GOLD STANDARD ALBUMS OF ALL-TIME. THE UPPER 99.9% OF all-time versus the upper 99.9

GOLDEN AGE OF DEATH METAL Abnormality “Contaminating The Mind Hive” until the next evolution in metallic savage factor occurs….!!

Surgikill “Sanguinary Revelations

Darkness “The Gasoline Solution”

Nervosa “Agony”

Tsjuder “Antiliv”

Winters of Sin “Violence Reigns Supreme”

Warfect “Exoneration Denied”

Nerovsa “Victim of Yourself”

Nervosa “Time Of Death”

Nervosa “2012”

Abnormality “Contaminating The Hive Mind

 

Golden Age of Death Metal  Leviathan”The Tenth Sub Level of Suicide” to “Impiety “Skullfucking Armageddon”  The next stage of Metallic authentic of the Death Metal Age if from

Gravehill “Rites of the Pentgram”

Sinners Burn “Insanity Warmachine”

Necromessiah “Antiklerical Terrorisk Death Squad”

Iperyt “Totalitarian Love Pulse”

Urgeheal  “Goatcraft Torment”

Carpathian Forest “FUCK YOU ALL !!!”

Centurions Ghost “A Sign of the Times”

Nocturanl Breed “Fields of Rot”

Dispiln “Antilife”

Occult “Elegy for the Weak”

Bloodreaping “Ingins Penumbra”

Killaman “Killaman”

Leviathan “The Tenth Sublevel of Suicide”

 

GOLDEN AGE OF DEATH METAL

Impiety “Skullfucking Armaggedon to Occult “Rage to Revenge”

 

Occult “Rage to Revenge

Kings-Evil “Deletion of Humanoise”

Nightside “End of Christianity”

Surrender of Divinity “Oriental Hell Rhythmic”

Vader “Litany”

Impiety “Skullfucking Armageddon”

 

GOLDEN AGE OF DEATH METAL

Cradle of Filth “Pleasures of Evil Made Flesh” to Impiety “Skullfucking Armageddon”

 

Pessiminst “Blood For the Gods”

Ritual Carnage ”

Nile “Amongst The Catacombs of the Nephren-Ka”

Nocturnal Breed “Agressor”

Crown of Thorns “Eternal Death”

Krisiun “Black Force Domain”

Naglfar “Vittra”

Mythos “Pain Amplifier”

Cradle of Filth “Principle of Evil Made Flesh”

 

GOLDEN AGE OF DEATH METAL Slayer “Show No Mercy” to Cradle of Filth “Principle of Evil Made Flesh”

 

Acheron “Rites of the Black Mass”

Decide “Deicide”

Entomed “Left Hand Path”

Bathory “Blood Fire Death”

Slaughter “Strappado”

Exumer “Possessed By Fire”

Destructi0n “Infernal Overkill”

Possesed “Seven Chuches”

Bathory “Bathory”

Slayer “Show No Mercy”

 

GOLDEN AGE OF DEATH METAL July 27th, 1983 to July 27th, 1990 Metallica “Kill ’em All to Deicide “Deicide”

GOLDEN AGE OF EXTREM METAL 1983-1989

…..still a work in progress…..

vanessanocera_thequeenofhorrormetal_520_9959

 

 

vanessanocera_thequeenofmetal_520_9958

 

sharronrazoblademoremetalthanmetal9784675323

 

 

carlaharveykickassmetalhallfoffame2015a99998958795978

 

carlaharveyworldclassvocalistheavymetallegend99996786785432a123123

carlaharveykickassmetalhallofame2015a98958795849846847

 

fernadalirakickassmetalheavymetalhallofamelegend987897897897878

collectorcornertop100heavymetalalltime987987987

kickassmetalcollectorscornerpullthetriggericonickickass987789758985664a23424214

surgikillgodlymajorragersheavymetalhallofame2015@2016

kickassmetalworldfamousebaycheatsheet987978978978675465332543

ABATTOIR • Vicious Attack

ACCEPT • Restless and Wild

ACID • Acid

ACID • MANIAC

ACID • Live in Belgium

AGENT STEEL • Skeptics Apocalypse

AGENT STEEL • Mad Locust Rising

ANACRUSIS • Screams and Whispers

ANNIHILATOR • Alice In Hell

 ANTHRAX • Fistful of Metal • Megaforce Records • MRI 069

ANTHRAX • Armed And Dangerous • Megforce Records • MRS 05

ANTRHAX • Spreading The Disease

ANVIL • Metal on Metal

ANVIL • Forged in Fire

ANVIL • Live in Concert

ANVIL CHORUS • Thought Crimes

ANVIL CHORUS  • The Killing Sun

ARTILLERY  • Fear of Tomorrow

ARTILLERY  • Terror Squad

ATHEIST  •  Piece of Time

ATHEIST  • Unquestionable Presence

ATTACKER  • Battle At Helms Deep

ATTACKER  • The Second Coming

ATTACKER  • Standing The Test of Time

ATTACKER  • Giants of Canaan

ATTACKER  • Sins of the World

BATHORY  • Bathory

BATHORY  • The Return…

BITCH  • Damnation Alley

BITCH  • Be My Slave

BLACK SABBATH  • Mob Rules

BLIND ILLUSION  • The Sane Asylum

BLOODLUST  • Guilty As Sin

BLESSED DEATH  • KILL OR BE KILLED • Megaforce Records • MRI 1369

BLITZKREIG  • A TIME OF CHANGES

CACOPHONY  • SPEED METAL SYMPHONY

CAGE  • Astrology

CANDLEMASS  • Nightfall

CANDLEMASS  • Ancient Dreams

CANDLEMASS  • Tales of Creation

CATHERDRAL  • Supernatural Birth Machine

CELTIC FROST  • Morbid Tales

CELTIC FROST  • Emperor’s Return

CELTIC FROST  • To Mega Therion

COVEN  • Witchcraft Reaps Souls and Destroys Minds

COVEN  • Jinx

COVEN13  • Worship New Gods

COVEN13 • Destiny of the Gods

CIRITH UNGOL  • Frost and Fire

CIRITH UNGOL  • King of the Dead

CRYPTIC SLAUGHTER  • Convicted

CULPPRIT  • Guilty As Charged

CYNIC  • Focus

DARK ANGEL  • We Have Arrived

DARK ANGEL  • Darkness Descends

DARK ANGEL  • Leave Scars

DEAF DEALER  • Keeper of The Flame

DEF DEALER  • Journey Into Fear

DARKNESS  • The Gasoline Solution

DEATH  • Scream Bloody Gore

DEATH  • Leprosy

DEATH  • Spirtual Healing

DEATH  • Human

DEATH  • Individual Thought Patterns

DEATH  • Symbolic

DEATH ANGEL • Act  III

DEATH STRIKE • Fuckin’ Death

DEEP SWITCH • Nine Inches of God

DESTRUCTION • Infernal Overkill

DESTUCTOR  • Maximum Destruction

DREAM DEATH • Journey Into Fear

DOCTOR BUTCHER • Doctor Butcher

EXCITER •  Heavy Metal Maniac

EXCITER • Violence & Force • Megaforce Records

EXCITER • Exciter • Double Play  Classic • Heavy Metal Maniac • Violence & Force • 1989 CD —Caroline/Megaforce Records

EXHORDER • Slaughter In the Vatican

EXODUS •  A Lesson in Violence • October 30th, 1984 Advance Cassette

EXODUS •Bonded By Blood

EXODUS • Pleasure of the Flesh

EXODUS • A Lesson In Violence (Live @ Studio 54 + March 1986 Paul Baloff Demos)

EXODUS • Another Lesson In Violence LIVE

EXODUS • Bonded By Baloff (A.L.I.V Remastered + Bonus Tracks)

EXUMER • Possessed By Fire

EXUMER • Rising By The Sea

FATES WARNING • Night On Brocken

FORBIDDEN • Forbidden Evil

FORBIDDEN • Twisted Into Form

The GATHERING • Mandylion

The GATHERING • Nightime Birds

GRAVE DIGGER • Heavy Metal Breakdown • Megaforce Records

• MRI 869

GRAVE DIGGER • Witch Hunter • Megaforce Records • MRI 1169

GRIFFIN • Flight of The Griffin

HAWAII • One Nation Underground

HALLOWEEN • Don’t Metal With Evil • October 30th, 1984 Advance Cassette Original Artwork

HALLOWEEN • Don’t Metal With Evil

HALLOWEEN • No One Gets Out!

HALLOWEEN • No One Gets Out! • Molten Metal Records Version features the “Vicious” Demo

HELL • “Hell” 1982 CD Demos Come on 2011 CD album

H-BOMB • Coup de metal

H-BOMB • Attaque

HEATHEN • Breaking The Silence

HEATHEN • Victims of Deception

HEATHEN • Recovered

HIRAX  • Raging Violence

HIRAX  • Not Dead Yet (Raging Violence) on CD

HOLOCAUST  • The Nightcomers

IMAGIKA • Imagika

IMAGIKA  • Worship

IMAGIKA  • And So It Burns

Imagika  •  Devil on Both Sides

INFERNAL MAJESTY  • None Shall Defy

INSTANITY  • Death After Death

IRON MAIDEN  • Iron Maiden

IRON MAIDEN  • Killers

IRON MAIDEN  • The Number of the Beast

JAGUAR  • Power Games

JAG PANZER  • Ample Destruction

JUDAS PREIST  • Killing Machine

JUDAS PRIEST  • Hell Bent for Leather

JUDAS PRIEST  • Unleashed In the East

JUDAS PRIEST  • British Steel

JUDAS PRIEST  • Painkiller

KING DIAMOND  • Fatal Portrait

KING DIAMOND  • Abigail

KING DIAMOND  • Them

KREATOR  • Endless Pain

KREATOR  • Pleasure To Kill

LIEGE LORD  • Master Control

MACABRE • Gloom

MALEDICTION • Condamnés

MALEDICTION • Esclave du vice

MANOWAR • Battle Hymns

MANOWAR • Into Glory Ride  • Megaforce Records

MANOWAR • Hail To England

MASSACRE  • From Beyond

MASSACRE  • Back From Beyond

MASTER  • Master

MASTER  • 1985 Unreleased Album

MEDIEVAL  • Medieval…aka 1983 Medieval Cassette Album

MEDIEVAL  • All Knobs to the Right

MEDIEVAL  • Reign of Terror

MEDIEVAL  • Medieval Kills

MEGADETH  • Rust In Peace

The MENTORS • You Axed For It

MERCYFUL FATE  • 1982 EP

MERCYFUL FATE  • Melissa

MERCYFUL FATE  • Don’t Break The Oath

MERCYFUL FATE  • Curse of The Pharaohs

MERCYFUL FATE Live From The Depths of Hell

MERCYFUL FATE  • The Beginning

MERCYFUL FATE  • Return of the Vampire

MERCYFUL FATE  • In The Shadows

METAL CHURCH  • Metal Church  • Ground Zero Records with Bonus Track “Big Guns”

METAL CHURCH  • Metal Church 1986 • CD on Elektra Records (C)1984 (P) 1986

METALLICA  • No Life ’til Leather

METALLICA  • No Life ’til Leather w/16 Minute Ron McGovney interview

METALLICA • Night of the Rivetheads — No Life ’til Leather w/Power Metal Demo — speed up

METALLICA  • Live Metal Up Your Ass

METALLICA  • Kill em ‘ All • Megaforce Records • MRI 069

METALLICA  • Ride The Lightning • Megaforce Records

• MRI 769

METALLICA • Whiplash • Megaforce Records • MRS 04

METALLICA  • Creeping Death/Jump In the Fire Cd

METALLICA  • Master of Puppets

MORBID ANGEL  • Abominations of Desolation

MORBID ANGEL  • Altars of Madness

MORBID ANGEL  • Blessed are the Sick

MORBID ANGEL  • Covenant

MORBID ANGEL  • Domination

MORBID ANGEL  • Entangled In Chaos

Motörhead • Ace of Spades

Motörhead • N Sleep ’til Hammersmith

Motörhead • Iron Fist

Motörhead • Another Perfect Day

Motörhead • No Remorse

Motörhead • Orgamsatron

NASTY SAVAGE • Nasty Savage

NASTY SAVGE • Indulgence

NERVOSA • 2012

NERVOSA • Time of Death

NERVOSA • Victim of Yourself

NERVOSA • Agony

NIGHTMARE • Astral Deliverance

OBITUARY • Slowly We Rot

OBITUARY • Cause of Death

OBLIVION • From This Day Forward

OBLIVION • From This Day Forward

OVERKILL • Feel The Fire • Megaforce Records • MRI 1469

OZ • Fire in The Brain

OZ • III Warning

OZZYOSBOURNE• Blizzard of Ozz

OZZY OSBOURNE • Diary of a Madman

OZZY OSBOURNE • Tribute

PAGAN ALTAR • 1982 Demo Cassette

PAGAN ALTAR • Pagan Altar Volume 1

PAGAN ALTAR • Judgment of the Dead

PILE DRIVER • Metal Inquisition

PENTAGRAM • Pentagram

PENTAGRAM • Day of Reckoning

PENTAGRAM • Relentless • Pentagram retitled

PENTAGRAM • Day of Reckoning/Relentless • Double CD

PENTAGRAM • Be Forewarned

POSSESSED • Seven Churches

RAVEN • All for One • Megaforce Records • MRI 269

RAVEN • Live at the Inferno • Megaforce Records • MRI 969

RAZOR • Executioners’ Song

RAZOR • Evil Invaders

REPULSION • Slaughter of the Innocent

REPULSION • Horrified

RIOT • Fire Down Under

RIOT • Thundersteel

RIOT • Privilege of Power

The RODS • Wild Dogs

RUSH • A Far Well To Kings

RUSH • Permanent Waves

RUSH • Exit…Stage Left

RUSH • Signal

RUSH • Grace Under Pressure

RUSH • Power Windows

RUSH • Hold Your Fire

RUSH • A Show of Hands

RUSH • Chronicles

RUSH • Presto

RUSH • Test For Echo

RUSH • Differnet Stages — LIVE

 SABBAT • History of a Time to Come

SATAN • Court in the Act

SATAN • Suspended Sentence

SATAN • Live in the Act

SATAN • Life Sentence

SATAN • Trial By Fire –Live In North America

SATAN • Atom by Atom

SAVATAGE • Sirens

SCORPIONS • Taken By Force

SACRIFICE • Torment In Fire

SACRIFICE • Forward to Termination

SACRIFICE • Soliders of Misfortune

SACRIFICE • Apocalypse Inside

SEPULTURA • Beneath The Remains

SKULLVIEW • Kings of the Universe

SINDROME • Sindrome 2 demos on 1 CD

SINDROME  • Resurrection….

SLAUGHTER • Strappado

SLAUTER XSTROYES • Winterkill

SLAUTER XSTROYES  • Free the Beast

SLAYER  • Show No Mercy

SLAYER • Haunting The Chapel

SLAYER • Hell Awaits

SLAYER • Live Undead

SLAYER  • Reign in Blood

SODOM • In The Sign of Evil

SODOM • Obsessed By Cruelty

STORMTROOPERS OF DEATH •  Speask English of Die • Megaforce Records

SUCIDIAL TENDENCIES • Suicidal Tendencies

SYRIS • Unseen Forces

TANK • Filth Hounds of Hades

TANK • Power of the Hunter

TANK • This Means  War

TERRORIZER • World Downfall

TESTAMENT • Legacy

TROUBLE • Live 1983

TROUBLE • Trouble • Later retitled Psalms 9

TROUBLE • The Skull

TROUBLE • Run To The Light

TYGERS OF PAN TANG • Wildcat

TYGERS OF PAN TANG • Spell Bound

TWISTED SISTER • Under the Blade

UFO • The Wild, The Willing, The Innocent

UNSEEN TERROR • Human Error

VENOM • Welcome to Hell

VENOM • Black Metal

VENOM • At War With Satan

VIO-LENCE • Eternal Nightmare

VOI VOD • War and Pain

VOI VOD  • Rrröööaaarrr

WARGASM • Why Play Around?

WARFARE • Pure Filth

WARFARE • Metal Anarchy

WARFARE • Mayhem Fucking Mayhem

WARLOCK • Triumph and Agony

WARLORD • Deliever  Us

WARLORD • And the Cannons of Destruction Have Begun

WARLORD • Thy Kindgom Come • 1st EP and LP on CD

WARHEAD • Speedway

WARHEAD • The Day After

WATCHTOWER • Energetic Disassembly

WATCHTOWER • Control and Resistance

WITCHCROSS • Fit for Fight

WITCHCROSS • Axe to Grind

WITCHFINDER GENERAL • Death Penalty

WITCHFINDER GENERAL • Friends of Hell

WICHKILLER • Day of the Saxons

ZOSER MEZ • Vizier of Wasteland