Archives for posts with tag: THE GREATEST HEAVY METAL ALBUM OF ALL-TIME!

 

 

 

 

The Principle  of Evil Made Flesh February 24th, 1994

V Empire or Dark Faerytales in Phallustein *  April 22nd, 1996

Dusk and Her Embrace * August 18th, 1996

Cradle of the Beast *April 27th, 1998

PanDaemonAeon * July 27th, 1999

From the Cradle to Enslave  * November 2nd, 1999 — Music For NationS Pressing

From the Cradle to Enslave * December 14th, 1999 — Metal Blade Records Pressing

Midian *October 30th, 2000

Bitter Suites to Succubi *June 18th, 2001

Heavy Left-Handed and Candid * November 25th, 2001

Lovecraft & Witch Hearts *May 13th, 2002

Live Bait for the Dead * August 19th, 2002

Damnation and a Day * March 10th, 2003

 

 

 

 

 

 

 

Cradle of Filth is without a doubt the World’s Greatest Heavy Metal band of all-time, with 24 albums of which are on our TOP 100 HEAVY METAL ALBUMS OF ALL-TIME LIST, THAT IS 25% of the best of the best of the upper-echelon of the top-tier of the GOLD STANDARD, THE nearest closest band is Crest of Darkness, Motörhead probably has more, but has never held a #1 ranking in this publication, even though they are a subjective favorite band ever since I started webZine in August 1st 1980, then Slayer with 7 back to back classics from 1983 to 1990, a band like Metallica only has 2 top 100 albums of all-time listed with the KICK ASS METAL heavy metal hall of fame….!!!! There is a lot of wild fuck up’s in a few list, concerning Metallica, now that I will be taking back over the editorial and hall of fame aspect of this webZine, I will fix those fuck ups. But they were a very important part of the brilliant GOLDEN AGE OF HEAVY METAL from August 1st ,1981 to October 31st, 1986 even if there were MORE IMPORTANT AND MORE INFLUENTIAL ARTIST AND MORE LEGENDARY ARTIST from that time period !!!

The Golden Age of Gothic Metal as well as the Golden Age of Avant-Garde Metal, have the same GOLDEN AGE period this is from January  1ST, 1993 to July 27th, 2004 …. we specialize as a specialized press for this era, and a specialized press for TRUE NORWEGIAN GOTHIC METAL….and because there are tons of GOLDEN AGE OF HEAVY METAL 1981 -1986 AND GOLDEN AGE OF EXTREME METAL 1983 -1989 AND GOLDEN AGE OF DEATH METAL JULY 27TH, 1990 TO INFINITE…….SINCE THIS MUSIC IS UNTOUCHABLE FOR COMMERCIALIZATION, where Power Metal and Thrash Metal, was watered down heavily in 1985, the slow-down syndrome in 1987, and a dead genre by 1991, with all the thrash metal clubs closing down, and September 24th, 1991 being the final nail in that coffin !!!!!!!!!!!!!!!!! Never forget this I tell my student and true fans who I meet every day, and this is THE IMPORTANT FACT TO CONSIDER WHEN COLLECTING Heavy Metal…If a webZine did not have a PRINT EDITION during the GOLDEN AGE OF HEAVY METAL 1983–1989, and was not a monthly or bi-monthly publication, then everything on there webZine is revisionist and all-top 100 albums list are pure non-sense with a false inclusion rate of over 95-99 percent with a glaring omission rate also at 95-99p percent, but keep in mind there were a lot of mistakes made back then concerning heavy metal….put nothing like the hundreds of millions to a billion mistakes over @ say Metal Archives and the likes…since so many marketers, anti-genre metallers, revisionist are allowed to have free accounts, and there is no one with the intelligence or bravery to have quality control, since they were never heavy metal fans in the first place since before the NWOBHM like I was back in the Summer of 1978…..!!!

 

But during METAL’S GREATEST GENERATION the GOLDEN AGE OF GOTHIC METAL January 1st, 1993 to July 27th, 2003 Cradle of Filth had 13 TIMELESS MASTERPIECES UNLEASHED ON PLANET METAL BACK THEN, DURING THE MOST INTENSE COMPETITION IN THE HISTORY OF THE GENRE…!!! As a matter of historical record, it is quite noticeable that most of the over-rated bands in the 1980’s were washed-up, sold-out, switched genres, bounced around from trend to trend, and 99.9% of the 1980’s metal bands could not cut it in the 1990’s!!!! Every serious metal publication on a daily basis, talks about when a band, washes-up/sells-out/becomes a tribute band with original members, then from there a cover bands of the tribute band, of that which sold-out and earlier washed-out!!! But if a traditional metal band never sold-out they will get coverage here….keep in mind that this is a GOTHIC METAL publication in the AVANT-GARDE age, the GOTHIC METAL age, and the DEATH METAL age of heavy metal, since July 27th, 1990 for Death Metal, and January 1st, 1993 for Gothic Metal and Avant Garde Metal, and the CONCEPT OF SELLING OUT and BEING A POSER, has never been part of the GOTHIC METAL COMMUNITY culture, in the first place!!! Before Gothic Metal and Avant-Garde metal before we had our first bands starting with Celtic Frost “Into The Pandemonium” in November 2nd, 1987…I was heavily involved in the HEAVY METAL UNDERGROUND, where I could only get my METALLIC ADDICTION FIX in small increments, and Celtic Frost “Into The Pandemonium” was the 1st HEAVY METAL ALBUM where the boundaries of POPULAR SONGWRITING/ HARD ROCK/HEAVY METAL/AVANT-GARDE CLASSICAL MUSIC/ HORROR MOVIE MUSIC/ CLASSICAL MUSIC, not only mattered, but created a new head-space….the GODSEND I was l@@king for, and got more of this metallic addiction fix in Ill-Literature Magazine and in July 27th, 2004 Avant-Garde Metal webZine went online, and has 4 of the greatest print editions of all-time….!!!!

 

In the spirit and vibes of Ill-literature this publication is put together by Connoisseurs of World-Class Heavy Metal, that which is in the UPPER-TIER OF THE UPPER-ECHELON OF THE GOLD STANDARD of the best of the best of artist that create supreme METALLIC immortal art of the highest order, and while the smartest people on Planet Metal knows everything in these pages, but this page like Ill-Literature is written for the new metal fans of the genre and looking at this webZine for the very 1st time!!!

And trust me on this….Cradle of Filth and their 24 top 100 heavy metal albums of all-time, is a band and altars of metallic mayhem, and HEAVY METAL HALL OF FAMES ARE BULIT AROUND THIS BAND, and these albums… I have 550 plus of Cradle of Filth CDs laying around the KICK ASS METAL offices, since I rebuy there back catalogue every year !!! I would never say to anyone, to buy 500 Cradle of Filth CD’s unless I have done so myself….I have 30 copies of albums such as Exodus “Bonded By Blood” Nervosa “Victims of Yourself” and Nerovsa “Agony” I tell my readership in person and in these pages to do the same….because I have !!!!!!!!!!!!!!

 

Cradle of Filth are THE UNDISPUTED KINGS OF HEAVY METAL AND THE UNDIPUTED WORLD’S GREATEST HEAVY METAL BANDS SINCE 1994…AND GOING ON…………………..30 YEARS OF THE GREATEST HEAVY METAL BAND OF ALL-TIME!! Since we are a Specialized Press for the Brilliant True Norwegian Gothic Metal and Dark Metal, Avant-Garde Metal, Horror Metal Genres…we have a GREATEST BAND OF ALL-TIME SYSTEM where a NORWEGIAN BAND IS LISTED AND A INTERNATIONAL band is listed, ie a band not from the legendary TRUE NORWEGIAN GOTHIC METAL MOVEMENT !!!

 

We do look at each of the 130,000 bands in heavy metal objectively but since I have studied music theory, taking 18 music classes in 6th grade to 12th grade…they wanted top-tier academicians…aka honor roll students who were football players to have refinement back in the early 1980’s….since I know metal history and music theory inside out and upside down…I know subjectively the music that causes the most evocation and the albums that are the most MOLTEN METAL, face MELTING, MIND BLOWING, JAW DROPPING, CHILLS AND UP AND DOWN THE SPINE….and from the subjective point of view…I write from this perspective !!! And anyone claiming to be “academic” and “objective” are ALWAYS FULL OF SHIT, because music is a true subjective music experience …and I know for a fact they were never around during the founding days of NWOBHM and the founding days of the glorious 1980’s underground metal movements!!!!! It is not their age that gives them away, it is just the fact, they have no fucking idea what the fuck they are talking about to the point of there webZines being pure fiction @ best and revisionist all the fucking way!!!!!Because they were never there in the first place !!!!!!!!!  Like with any band featured in these pages, good luck opening aN ACTUAL metal publication, and not seeing an advertisement, an album review, a write-up, or an interview on these HEAVY METAL GODS AND HEAVY METAL LEGENDS…..AND good luck fuckers who think they are going to cute not put them in a heavy metal history book..good luck fuckers !!!!!!!!!!!!!!!!!!!!!!!!!!! If you do the work and have the achievements we will give you this kind of coverage EARNED….because this bands has had my TRUST AND RESPECT SINCE DAY 1 in February 24th, 1994…..!!! And it was a beautiful thing to see @ work. Decide “Legion” being taken down as the GREATEST HEAVY METAL ALBUM OF ALL-TIME, and seeing CRADLE OF FILTH “THE PRINCIPLE OF EVIL MADE FLESH”…..BEING put up as the GREATEST HEAVY METAL BAND OF ALL-TIME, AS WELL AS THE GREATEST HEAVY METAL BAND OF ALL-TIME……CRADLE OF FILTH/ CREST OF DARKNESS ARE KICK ASS METAL’S #1 HEAVY METAL RANKED BANDS OF ALL-TIME AND OF ALL-GENES…there are number 1 rankings for each of the HEAVY METAL GENRES….year in and year out, there will always be write-ups like these METAL LEGENDS AND METAL GODS…not just here but World-wide, year in and year out, since 1994……..there is no band who left a more permanent indelible mark on the psyche of actual heavy metal fans world-wide and has the biggest scar left on the history books of WORLD-CLASS HEAVY METAL !!!!

Cradle of Filth SELECT DISCOGRAPHY all TOP 100 HEAVY METAL ALBUMS OF THE YEARS THEY WERE UNLEASHED ON PLANET METAL and ALL-ON OUR TOP 100 HEAVY METAL ALBUMS OF ALL-TIME LIST !!!

 

The Principle  of Evil Made Flesh February 24th, 1994

V Empire or Dark Faerytales in Phallustein *  April 22nd, 1996

Dusk and Her Embrace * August 18th, 1996

Cruelty and the Beast *April 27th, 1998

PanDaemonAeon * July 27th, 1999

From the Cradle to Enslave  * November 2nd, 1999 — Music For NationS Pressing

From the Cradle to Enslave * December 14th, 1999 — Metal Blade Records Pressing

Midian *October 30th, 2000

Bitter Suites to Succubi *June 18th, 2001

Heavy Left-Handed and Candid * November 25th, 2001

Lovecraft & Witch Hearts *May 13th, 2002

Live Bait for the Dead * August 19th, 2002

Damnation and a Day * March 10th, 2003

Nymphetamine * September 27th, 2004

Peace Through Superior Firepower * November 22nd, 2005

Thornography *October 16th, 2006

Eleven Burial Masses *May 5th, 2007

Godspeed on the Devil’s Thunder * October 20th, 2008

Darkly, Darkly Venus  Aversa * November 1st, 2010

Evermore Darkly * October 17th, 2011

Midnight in the Labyrinth *April 21st, 2012

The Manticore and Other Horrors * October 30th, 2012

Hammer of the Witches * July 10th, 2015

Dusk… and Her Embrace – The Original Sin *July 8th, 2016

Cryptoriana – The Seductiveness of Decay *  September 22nd, 2017

 

 

Malevolent kings of British metal. Masters of the darkest arts and crafts. Cradle Of Filth have been firmly ensconced at the forefront of the extreme music scene for the last two decades. Ever since they emerged from the lengthening Suffolk shadows in 1991, Dani Filth and his fiendish cohorts have blazed a grotesque trail across the globe, spreading their fetid gospel of obscene theatricality, pitch-black horror and exquisite musical madness, earning themselves a formidable reputation as one of the most important metal bands ever.

After unleashing three nefarious demo recordings, Cradle Of Filth began their campaign of dastardly destruction in earnest with the release of 1994’s ferocious debut album The Principle Of Evil Made Flesh, laying down a blackprint for everything that would follow, as Mr. Filth’s unhinged vocal versatility and gloriously twisted literary skills collided with a grandiose barrage of scything riffs, macabre atmospherics and bone-wrenching brutality. Upping the abominable ante for 1996’s Vempire EP and its full-length follow-up, Dusk…And Her Embrace, Cradle Of Filth rapidly established themselves as standard bearers for the UK’s dark metallic underground, consolidating that status with increasingly extravagant and dramatic live shows that put the meagre efforts of their contemporaries to shame. By the time 1998’s grand concept piece Cruelty And The Beast was unveiled, Cradle had already started to prod the mainstream’s vulnerable ribcage with their scathing wit and self-deprecation, making a notorious appearance on BBC2 documentary Living With The Enemy that enabled them to scare the merry hell out of startled viewers across the length and breadth of Britain. After Dani set his stalwart songwriting partnership with guitarist Paul Allender (who had returned for a second tenure with the band), 1999’s From The Cradle To Enslave even managed to scale the battlements of the mainstream pop charts, hastening the band’s growing stature as hated household names and music press anti-heroes.

As the new millennium dawned, Cradle Of Filth tapped a new vein of rich creativity with their fourth studio album Midian; a dizzying eruption of cinematic grimoire and razor-sharp sonic viscera that paved the way for a steady stream of similarly monstrous releases, including their own horror movie (2000’s underground success Cradle Of Fear). With an ever-growing penchant for augmenting their gruesome sound with ornate orchestration and all manner of disparate aural mischief, the band bestrode the decade with supreme confidence. Damnation And A Day, the Grammy-nominated Nymphetamine and Thornography all cast their sickly shadow on an otherwise impoverished music world, and countless world tours and festival triumphs duly followed on the whims of major label status.

Clicking into a higher and more hideous gear, Cradle displayed their contempt for taking the easy route with 2008’s Godspeed On The Devil’s Thunder, another labyrinthine concept work that told the vile saga of legendary knight and serial killer Gilles de Rais via some of the band’s most aggressive and intense material to date. Sustaining that sickening momentum with 2010’s similarly brutish and melodramatic Darkly Darkly Venus Aversa, our beloved filthmongers have shown no signs of slowing the pace of their creative flow, and have entered the second decade of this new century in the rudest and most rampant of health.

And now, it is time for the well-oiled gates of Midian to swing violently open once more as Cradle Of Filth prepare to release their tenth studio album, the all-powerful and undeniably terrifying The Manticore And Other Horrors. Recorded in eight to ten weeks at Springvale and Grindstone studios (where revered engineer Scott Atkins weaves his monstrous gloss), the new album comprises a collection of chilling tales of “personal demons, Chimeras, literary fiends and world-enslaving entities…” while showcasing the ongoing redefining and remorseless mutation of the classic Cradle sound, with an ever-more vicious underbelly of punk-fuelled black metal carnage driving the likes of monumental title track Manticore, the obnoxiously infectious For Your Vulgar Delectation and towering slabs of spew-drenched steel like The Abhorrent and Siding With The Titans breathlessly and brutally forward. With tentative plans for a release on Hallowe’en 2012, this is the ultimate Cradle Of Filth experience to date, complete with horrific live show come November and December, the band headline-touring in Europe.

‘This is our tenth commandment in metal,” proclaims Dani Filth. “We have diversified and kept alive the spirit of this band and breathed into it something that, I can proudly say, slays like an absolute motherf**ker. The Manticore is coming…Long live the filth!’

 

IF FOR SOME STRANGE AND BIZARRE REASON YOU WANT TO CALL OUR CUSTOMER HOTLINE THE NUMBER IS
1 800 FUCK YOU
AND IF NONE IS THERE PLEASE FEEL FREE TO CONTACT US ON OUR MOBLIE
@
1800 FUCK YOU
SO WE CAN HAVE A CIVILIZED CONVERSTION NOT REALY….. NOT!!! PSYCHE !!!
IF NO ONE IS THERE PLEASE CALL OUR PUBLIC RELATIONS SPEICALIST JENNY @
876-5309
ASK FOR JENNY !!!

 

 

 

 

 

Advertisements

 

 

 

 

 

KICK ASS METAL WANTED TO APOLOGIZE TO THE HEAVY METAL COMMUITY FOR NOT PUBLISHING THIS ARTICLE, ON MAY 12, 2017 .

Since May 12th, 1999.

From May 12th, of each year to May 12th of the Next Year. We have been l@@king for the Greatest Heavy Metal album of all-time….As a Metal fan since 1978. I know most people know by now the readers who have meet me in person that THE GOLDEN AGE OF HEAVY METAL was from August 1st, 1981 to October 31st, 1986. But there have been a few dozen GOLDEN AGES FOR HEAVY METAL, The Death Metal AGE/THE GOLDEN AGE OF DEATH METAL, The Avant-Garde Metal AGE,/THE GOLDEN AGE OF AVANT GARDE METAL, The Gothic Metal AGE/THE GOLDEN AGE OF GOTHIC METAL…I have never been stuck in the TIME WARP of 1980’s METAL ONLY…..Most of my favorite albums are from

January 1st, 1993 to March 10th, 2003. Basically the Begin of the Gothic Metal age to Cradle of Filth’s “Damnation and A Day’.

THE EVOCATION I EXPERIECED WITH Crest of Darkness “The Ogress” was a MILLION TIME MORE POWERFUL than Metallica “Kill ’em All” on August 1st, 1983, when the second pressing hit the stores after the first press run on July 25th, 1983, Mercyful Fate “Melissa” on October 30th, 1983. or with Morbid Angel on May 12th, 1989…….exactly 10 years apart from Crest of Darkness “The Ogress” which happened on May 12th, 1999…..!!! Or Deicide

Sure there have been some close calls….Displin “Anti Life” was close !!! as well as Iperyt “Totalitarian Love Pulse”…..!!!!

We review actual heavy metal and actual world-class hard rock, world-class avant-garde, and World-Class Classical Music, every year on February 13th, of each year. We have to listen to the so called “Metal Media” and the “Metal Press” top album of each year…..and I am actually shocked at how our peers, and our inferiors….really do not know the essence of heavy metal!!!! Which makes there top 100 albums and albums of the year each year STRANGE AND BIZAREE TO SAY THE LEAST!!!!!!!!!!!!!!!!!

KICK ASS METAL offices were closed for the Weekend for the 18th anniversary of this KICK ASS METAL feature for MOTHERS DAY….!!!!!!!! I gave everyone off that weekend, and even myself…so for that reason and that reason only, that this article was not written on May 12th, 2017 !!!!!

In 2017 the TOP album so far is Infernäl Majesty “NO GOD” it will enter a TOP 100 or a TOP 700 ALBUMS OF ALL-TIME LIST FOR SURE, because that album is PURE FUCKING MOLETEN METAL…..!!!!!!!!!

CREST OF DARKNESS FOUNDED IN 1993 and it is May 21st, 2017 and GOING ON

30 YEARS OF THE GREATEST HEAVY METAL BANDS OF ALL-TIME !!!!!!!!!!!!!

LONG LIVE CREST OF DARKNESS !!!!

 

 

 

kickassmetalheavymetalhalloffamelegnd9879789678563452323423423

 

welcometokickassmetal98568754a3131232

KICK*ASS*METAL Proudly Presents its December 2016 Playlist …..

kickassmetalkickasslikealoadguninyourfaenoremorse98797568543

 

Abattoir “Vicious Attack”

Abnormality “Mechanisms of Omniscience”

Attacker “Battle At Helms Deep”

Attacker “The Second Coming”

Attacker “Giants of Canaan”

Attacker “Sins of the World”

Blues Pills “Blue Pills”

Blues Pills “Lady In Gold”

Coven “Witchcraft Reaps Souls and Destroys Minds”

Darkness “The Gasoline Solution”

Diamond Head * Lighting To The Nations

…Different artwork….

…HNE 2 DISC VERSION…

Dismal Euphony “All Little Devils”

Dismal Euphony “Python Zero”

Candlemass “Behind Wall of Doom”

Carl Orff “Carmina Burana”

Christmas MUSIC via WNIC radio station…only 8 daze left of that….!!!!!!!! ….then its Halloween, everyday is Halloween…!!

kickassmetalheayvmetalhalloffamechristmasmusicdecember99989787898797898

kickassmetalmerrychristmas12252016

kickassmetalheavymetalhallofametalhallofamechirsmassmusic9897898865734

 

Crest of Darkness “Sinister Scenario

Crest of Darkness “The Ogress”

Crest of Darkness “Project Regeneration”

Crest of Darkness “Evil Knows Evil”

Crest of Darkness “In The Presence of Death”

Crest of Darkness “Welcome The Dead”

Destruction “Under Attack”

Doro “Strong and Proud” LIVE CD

Edge of Paradise “Mask”

Edge of Paradise “Immortal Waltz”

Exciter “Heavy Metal Maniac”

Exodus “Bonded By Blood”

Exodus “A Lesson In Violence” 1991 Combat CD LIVE Studio 54 and March 1986 Paul Baloff Demo.

Exodus “Bonded By Baloff”

Exodus “A Lesson In Violence” LIVE CD

Halloween “Don’t Metal With Evil”

…everyday is Halloween when you really think about it…

Heaven and Hell “The Devil You Know”

Hovanhess * Symphonies 50 and 22 — DELOS 1993 CD Pressing

KICK AXE “VICES” ……Heavy Metal Shuffle….

Rock Candy Version, SUPERIOR PRESSING OVE THE WOUNDED BIRD EDITION

Lucifer “Lucifer I”

Madder Mortem “Red Tooth In Claw”

Mercyful Fate “Melissa”

Mercyful Fate “Don’t Break The Oath”

Nervosa “2o12”

Nervosa “Time of Death”

Nervosa “Victim of Yourself”

Nervosa “Agony”

The Pretty Reckless “Who You Selling For”

Razor “Evil Invaders”

Satan “Court In The Act”

Theates Des Vampires “Candyland ”

The Vision Bleak “Wolves Go Hunt Their Prey”

The Vision Bleak “Timeline”

Zoser Mez “Visizer of Wasteland”

 

abattoirtop100heavymetalalbumsalltime9898977675654

abattoirviciousattacktop100heavymetalalbumsofalltime9879876

diamondheadlightingtothenationskickassmetalhallofamealbum98978789789

 

darknesstop100heavymetalalbumsof2016a8988978978987978

darknessthegasolinesolutionkiccassmetaslmetaslheavymetalhallofamealbum9879789787898

darknessthegasolinesolutionkickassmetalheavymetalhallofamealbum987789789789789

kick_ass_metal_RULES-NERVOSA_RULES_1531855_415181481969274_188441262536555540_n

darknessthegasolinesolutiontop100heavymetalalbumsofalltime9997897897897878

fernadalirakickassmetalheavymetalhallofamelegend987897897897878

kickassmetalheavymetalhallofamealbums8978989789978966355654

nervosa2012top100heavymetalhalloffamealbumsofalltimemetalgodslegends9768967875463

nervosaterraamaralliraeraheavymetalhalloffamemarch2012a999877771

 

nervosatimeofdeathtop100heavymetal989897677

nervosaallfemalethrashmetaltop100ofalltime9898765674

nervosavictimofyourselftop100heavymetalalbumofalltime5a9879876661

nervosaheavymetalgodslegends98797896772341413431242323423

nervosaagony2016heavymetalalbumoftheyear2016989789789677634453454

nervosaagony2016heavymetalablumoftheyear2916metalleegnds-9896968677546342345423234534

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

margaritamonetkickassmetalheavymetalhallofffame9896856432468967a31133

edgeofparadisekickassmetal97868786785745a9999

edgeofparadisemaskkickassmetalheavymetalhalloffamealbum998768768456353453453534

edgeofpardise_immortalwaltz_may22nd2015_album_artwork987653432131334n

candlemassbehindthewallofdoomheavymetalkickasshallofameartist978978789

satancourtintheactkickassmetaslheavymetalhallofame97897897897889

heavnandhellthedevilyouknow98987979787899789978789

 

kickaxeheavymetalshufflekickassmetaslheavymetalhallofamealbum879789967545

kickaxevicesfirstcdofthelegndaryalbumkickassmetalheavymetalhall98797985645

kickaxekickassmetalheavymetalhallofamealbum-99998988967745jpg

kickasskickaxeheavymetalhallofame99999897897897898978978

taylormomenkickassmetalmetallegend987978978978978978

taylormomsenkickassmetalheavymetalhalloffame98978978789897jpg

 

taylormomsenheavymetalhalloffame8797878978978978978978akickass

taylormomsenkickassmetalheavymetalhalloffamelegend987978789789789

The Vision Bleak, Wave-Gotik-Treffen 2013

thevisionbleaksetsailtoseaheavymetalgods98797897967563

thevisionbleakheavymetallegend967563234235656787653245677686865465435453534

 

thevisionbleakheavymetallegend78978987897676456534234

kristinfjellseth2012greatestworld-classvocalistofalltime87978978978

maddermortmeredinclawkickassmetalheavymetalhallofafealbum8797897789

johannasadonisheavymetallegendkickassmetalheavymetalhallofame87978987789

 

jinxdawsonkickassmetalheavymetalhallofamelegend9789797897889

jinxdawsonkickassmetalheavymetalhallofamelegends

jinxdawsonkickassmetalheavymetalhalloffamelegend7897897894634

jinxdawsonkickassmetalheavymetalhallofamelegends

mercyfulfatgekickassmetaltop5albumsofalltime1ofthegreatestbandsofaslltime989686563212

mercyfulfatedontbreaktheoathtop100heavymetalalbumofalltime9876987622

 

kickassmetalheavymetalhallofamealbumkickassmetal97896776323234

 

theatresdesvampirescandyland9676775463534234234

halloweendontmetalwithevil2ndcdartworkwithorangeborderpuresteel98746873523245

halloweendontmetalwithevilmcmpuresteel3songsfromviciousdemo98554a123432

halloweendontmetalwithevilkickassmetalheaymetalhallofame98896786734224423232jpg

halloweenheavymetalhallofamealbum19852ndartwork99999909897867546

 

kickassmetalheavymetalhallofamelegendsonyascarlet898778756234543

kickassmetalheavymetalhalloffamelegnd9879789678563452323423423

 

kimberlyfreemanheayvmetallegendkickassmetal9898978978634

kimberlyfreemankickassmetalheavymetalhalloffamelegend986796786766353434

 

 

 

 

crestofdarknessthegreatestheavymetalalbumofalltimeheavymetalmay1999a989576854

 

As of todays Writing * May 12th, 2016

KICK*ASS*METAL is celebrating the 17 year Anniversary

THE GREATEST HEAVY METAL ALBUM OF ALL-TIME

crestofdarkness_the_ogress_worldsgreatest_heavy_metal_bandsince_may12th1999-2016

 

Crest of Darkness “The Ogress”

 

The Top 5 Heavy Metal ALBUMS OF ALL-TIME ARE

In Chronological order

Coven “Witchcraft Reaps Souls and Destroys Minds”

Mercyful Fate “Melissa”

Crest of Darkness “The Ogress”

Riti Occulti “Riti Occulti”

Lucifer “Lucifer I”

 

 

Back When this album was first unleashed on Planet Metal on

May 12, 1999

 

The albums Riti Occulti “Riti Occulti” and Lucifer “Lucifer I” did not exist until 2010 and 2014….!!! So I have been waiting for a heavy metal album to top Crest of Darkness “The Ogress”, but The Keyboard Playing is the Greatest of all-time. Kristin Fjellseth SET THIS A PERFECT ALBUM ON FIRE, and gives it a extra HEAVINESS like no other before Crest of Darkness or Since this MOLTEN METAL MASTERPIECE was UNLEASHED ON PLANET METAL Back in May 12th, 1999

 

crestofdarknesstheworldsgreatestheavymetalbandofalltime987957698574321

kristinfjellsethkicakassmetalheavymetalhallopffamelegend9896854t2123423541

 

crestofdarknesstheogressthegreatestheavymetalalbumofalltime1999toinfintiy9784321

Right now at 6,205 days as the WORLDS GREATEST HEAVY METAL ALBULM OF ALL-TIME since May 12, 1999.

I have expected a couple of albums to top this album, every three months and every season, a new top 100 album in heavy metal album is unleashed on Planet Metal, it is just natural genre evolution. But what will always keep this in THE KICK*ASS*METAL AND THE KICK*ASS*METAL HEAVY METAL HALL OF FAME as the greatest album of all-time.

Crest of Darkness understands the essence of metal like no other. And I really doubt any female backing Vocalist will ever top what Kristin Fjellseth did on this album, as a WORLD-CLASS HEAVY METAL VOCALIST. And the Keyboard playing is top-notch second-to-none.

 

This is not my first time saying this that

Crest of Darkness “The Ogress” is the Greatest HEAVY METAL ALBUM OF ALL-TIME.

 

I have been saying it since this album was unleashed on Planet Metal on May 12, 1999.

 

So 17 year in a row, I have given praise to this MOLTEN METAL MASTERPIECE.

 

This has been the HEAVY METAL GOLD STANDARD FOR SO LONG, others who try for top 100 albums a year/decade/century, fall short, because they never have there pulse on all things AUTHENTIC and all things KICK*ASS.

 

I have my top 100 list compiled by 700 of the greatest minds in heavy metal. But at the end of the day, I have the final vote on this, and I wanted to thank everyone who gave me great top 100 Heavy Metal list of all-time, starting in 1986, and during the GOLDEN AGE OF HEAVY METAL 1993-2003….For this, I can not express in words my gratitude.

 

 

crestofdarknesstheogressthegreatestheavymetalalbumofalltime1999toinfintiy9784321

 

 

 

 

 

 

 

 

 

butcherbabiesworldclassheavymetal9789898a2015

 

British extreme metallers CRADLE OF FILTH have canceled the first four shows of their “Inquisitional Tourture” North American headlining tour due to U.S. visa issues.

Says CRADLE OF FILTH frontman Dani Filth: “With a massively heavy heart, CRADLE OF FILTH have to announce the cancellation (for now at least) of our first four shows in the U.S, because of a visa issue with the American embassy. We are doing everything in our power to rectify this situation as fast as possible. It is an nightmarish situation for all and we can only apologize for all those fans who have bought tickets. Thank you for your understanding and please be assured we are doing everything we can to be with you as soon as is humanly possible and that should be 31st January in Charlotte, North Carolina. We look forward to seeing you then. For refunds, please contact your point of purchase. We apologize for any inconvenience caused.”

Affected dates:

Jan. 26 – Philadelphia, PA @ Theater of the Living Arts
Jan. 27 – Boston, MA @ House of Blues
Jan. 28 – Baltimore, MD @ Baltimore Soundstage
Jan. 29 – Raleigh, NC @ The Ritz

Support on CRADLE OF FILTH’s North American tour will come from BUTCHER BABIES and NE OBLIVISCARIS.

CRADLE OF FILTH’s eleventh studio album, “Hammer Of The Witches”, was released on July 10 via Nuclear Blast. The CD marks the first release with CRADLE OF FILTH’s new lineup, which includes new guitarists Ashok (of Czech groups ROOT and INNER FEAR) and Richard Shaw (of English acts EMPEROR CHUNG and NG26).

Asked what inspired the songs for “Hammer Of The Witches”, CRADLE OF FILTH singer Dani Filth told HorrorNews.net: “It was an amalgam of lots of different things, I suppose. When I began writing the album, I had a new clip of about four songs before I started coming up with an idea. You could say it is well hilted in the medieval. I mean, there is a track called ‘On Christian Soldiers’, which is about the first crusade and draws comparison with modern day — as do a lot of the songs, but I think the medieval scenario is the vibe that suits the material. I was working one day in my office and I have a library of books. I saw the ‘Malleus Maleficarum’, which is the medieval, gothic book about witchcraft that translates to Hammer Of Witches, meaning it was a tribunal, like a punishment for witches, and the book itself was like a weapon against witchcraft. Obviously, hundreds of thousands people throughout Europe were put to death throughout the inquisition period and this book was partly responsible for that, I should imagine. But, anyway, we saw it as the weapon being in the witch’s hand. It is retribution, revival, reprisal, revolution and revenge. We can say that, because we are not a Christian band. So that was our interpretation of that. Then those things of revenge, revival, demonology, witchcraft which were also influenced by the area in which I live in England, which is known as a witch county.”

Regarding whether he looks at “Hammer Of The Witches” as CRADLE OF FILTH’s finest effort so far, Dani told RockSverige.se: “That’s a little hard to say. We never come out of the studio unless we are 100 percent happy. We’re really proud of this one. Whether it’s our finest album? Well, at least for the last ten years, I would say. That seems to be the premise and the opinion of the journalists I’ve spoken to. Whether it’s our best overall, I don’t know. It needs to sink in and people need to hear the album with the special-edition tracks as well. Those particular songs didn’t even know they were gonna be special-edition songs. The track list wasn’t carved in stone ’till close to the end of the mix, actually. It was a band thing and we had to have two songs as bonus material and everybody had good points about all of them, but two didn’t make the grade. But somebody might prefer one or both of the songs. Unfortunately, it’s the way it is. We actually turned down three songs that were written for the album. We made a conscious decision not to spread ourselves too thinly. One of the tracks was one of my favorites, but that just proves there’s democracy in this band. Everybody contributed and that’s testament to that the album is killer.”

 

 

butcherbabiesworldclassheavymetal9789898a2015
Select Cradle of Filth Discography

Cradle of Filth * The Principle of Evil Made Flesh * February 24th, 1994

Cradle of Filth * V Empire or Dark Faerytlaes in Phallustein * April 22nd, 1996

Cradle of Filth * Dusk And Her Embrace * August 28th, 1996

Cradle of Filth * Cruelty And The Beast * April 27th, 1998

Cradle of Filth * PanDaemonAeon * 1999

Cradle of Filth * From The CradleTo Enslavye * November 2nd, 1999

Cradle of Filth * Midian * October 30th, 2000

Cradle of Filth * Heavy Left-Handed and Candid * November 25, 2001

Cradle of Filth * Lovecraft & Witch Hearts * May 13th, 2002

Cradle of Filth * Eleven Burial Massess / Live Bait * August 19th, 2002

Cradle of Filth * Damnation and a Day * March 10th, 2003

Cradle of Filth * Nyymphetamine * September 27th, 2004

Cradle of Filth * Peace Through Superior Firepower * November 22nd, 2005

Cradle of Filth * Thronography * October 16th, 2006

Cradle of Filth * Godspeed on the Devil’s Thunder * October 20th, 2008

Cradle of Filth * Darkly, Darkly Venus Aversa * November 1st, 2010

Cradle of Filth * Evermore Darkly * October 17th, 2011

Cradle of Filth * Midnight In The Labyrinth * April 21st, 2012

Cradle of Filth * The Manticore and Other Horrors * October 29th, 2012

Cradle of Filth * Hammer of The Witches * July 10th, 2015

Below is KICK*ASS*METAL’s TOP 5 album of all-time. The subject matter of KICK*ASS*METAL is authenticity and supreme metallic art of the highest order. Obviously We consider ourselves a specialized press for all things KICK*ASS, BAD*ASS across the spectrum of Gothic Metal. And the Gothic aesthetic found in Gothic rock, classical where the gothic aesthetic is heavily pronounced  and the avant-garde. For Avant-Garde Metal, mostly along the line of Industrial / Gothic / Symphonic Gothic and we look for authenticity the kind of artistry that is found is the structure and depth of classical music.

Our top 5 favorite albums and the Top 5 Greatest Heavy Metal albums of all-time are in chronological order are

Coven “Witchcraft Destroys Minds and Reaps Souls”,   Mercyful Fate “Melissa”, Cradle of Fitlh & Crest of Darkness “The Ogress” go hand in hand. Riti Occulti “Riti Occulti” and Lucifer “Lucifer I”. KICK*ASS*METAL is a specialized press we cover TRUE METAL what the mainstream heavy metal press calls Extreme Metal or Dark Metal

coven_witchcraft_97846743432png
mercyfulfatemelissatop100ofalltime9878765433a1983
mercyfulfate_dontbreaktheoath_97946735342
cradleoffilthworldsgreatestbandinternartional1994a9789679486
crestofdarknessthegreatestheavymetalalbumofalltimeheavymetalmay1999a989576854
riti_occulti_logo_8_20131150965_698249283522835_8126918_n
Riti_occulti_album_cover_560633_425821540765612_536904424_n
luciferluciferItop5albumofalltime985795a2014

jinxdawson_kickassmetal_666_99994

I have not seen to many articles of the Greatest Melodic Hard Rock/ Heavy Metal Vocalist of all-time. So it was time to write a article about the Greatest Melodic Hard Rock / Heavy Metal Vocalist for the 20th Century and the Greatest Melodic Hard Rock Vocalist of the 21st Century

 

The 20th Century WINNER is

Jinx Dawson * Coven FAME

kam_jinx_dawson_9877

 

The 21st Century WINNER is

Johanna Sadonis * The Oath & Lucifer *  FAME

johannasadonisworldsgreatestvocalistfofthe21stcentury999758686a2015

 

kam_johannasadonis_9876

 

jinxdawson_kickassmetal_666_9999

 

theoathbandkickassmetalheavymetalhalloffame978468743

coven_witchcraft_97846743432png

kickassmetallucifertop5albumofalltime97648777886662

 

jinxdawson_kickassmetal_666_9796

jinxdawson.kickassmetal_666_9995

 

Everyone who knows me personally KNOWS that my favorite top 5 albums of all-time. And from the top 700 albums of all-time, these 5 albums are the fundamental / essential albums for a serious World-Class Heavy Metal Record Collection. These five albums along with 5 others are the most played albums in my play list since I have been a true metal fan since 1978 with the Commercial Major Label Stuff, and I got involved in the Independent Metal Movement and the Metal Underground, in the Summer of 1980

Are in Chronological Order

Coven * Witchcraft Destroys Minds and Reaps Souls * Mercury Records * January 1st, 1969

Mercyful Fate * Melissa — Megaforce / Important Records * October 31st, 1983

Crest of Darkness * The Ogress

Riti Occulti * Riti Occulti

Lucifer * Lucifer I

 

I though in my life-time I would never find a album to fit in perfectly in between spins of the ALL-TIME CLASSICS Coven “Witchcraft Reaps Souls and Destroys Minds”and the ALL-TIME CLASSIC Riti Occulti “Riti Occulti”. But Johanna Sadonis achieved this impossiable task last year and I have ranked / rated Lucifer as the 5TH GREATEST KICK*ASS*METAL BAND OF ALL-TIME, Coven and Lucifer claim a affinity for melodic hard rock, and since these bands are MASTERS of the key concepts of HEAVY METAL, World-Class Melodic Vocals, and Top-Notch Stellar Guitar Work, every Serious Heavy Metal fan, has to ignore the hard rock / heavy metal genre classification line. And just Worship TRUE METAL at the altars of Coven and Lucifer.

 

 

 

 

 

 

It is around 47 years apart between the Coven and Lucifer debut albums….and this was a once in a life-time event in World-Class Music and World-Class Heavy Metal.

The album Lucifer “Lucifer I” gets 12 spins in my CD player every day, since it was unleashed on Planet Metal.

 

jinxdawson_kickassmetal_666_9989

mercyfulfatemelissatop100ofalltime9878765433a1983

mercyfulfatedontbreaktheoathtop100heavymetalalbumofalltime9876987622

Riti_occulti_album_cover_560633_425821540765612_536904424_n

kickassmetallucifertop5albumofalltime97648777886662

lucifer_logo_credit_alan_forbes_10429245_387757681382234_2144704664419354821_n

kickassmetallucifertop5albumofalltime9874686537436256

sos_kam_files_10257084_728170330579737_5292882701749479413_o

Cradle of Filth  (United Kingdom)

Cradle of Filth (METAL GODS)

Dusk And Her Embrace

kickassmetal_cd_mfn_fmmfm_1096_8798785798536424

kickassmetal_wordpress_cof_fmmfnn_11096_987564364564526

kickassmetal_cof_cd_fmmfn_11096_98798798724567

kickassmetal_cof-cd_fmmfn11096_98798769787654

UNLEASHED ON PLANET METAL

 

Every once in a while, a TIMELESS MASTERPIECE album will make it rounds via, eBay, a real classic, a real HEAVY METAL hall of fame album.

And for some reason collectors of power/ thrash / metal will not research the genre from the genre’s leading publications, but will use free record review sites, where the writers are allowed to dislike HEAVY METAL, not only owing the album, but if you never even heard the ablum, thats even better. Your 17 out of 100 record review, good job, right into the pile.

So its Crunch time, and the auction is winding down. So you got some-time to social proof so you want to read some average record reviews, from below average heavy metal minds, ie the ones where not around as fans in October ’81, October ‘ 82 or late comers to the genres in October ‘ 83 (I have been a heavy metal fan since 1978 and an extreme metal fan since the Summer of 1980), since they were not around, why do research, on heavy metal genre, THE EASIEST genre of music to do research on when then can write for 9th rate publications. And you’re in there core demographic. And your a moderator of there boring forum. a REAL BORRUM…!!!!!!!!

So since time is not off the essence , got around 9 minutes to the auction ends. So time for some social proofing.

Its the Week of March 6th, 2015

Cool whoa dude, this one of the greatest albums of all-time has a average rating of 84 out of 100

the next scores are as follows…

100, 100, 93, 100, 90, 95, 91, 95, 83, 97, 1%,, 80, 98, 98, 59, 80, 60, 98

With an average score of 84

Not bad huh,

EXCEPT it is one of the GREATEST HEAVY METAL albums of all-time

FROM THE NUMBER 1 RATED BAND IN HEAVY METAL INTERNATIONAL since 1994,

1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015.

20 YEARS PLIS AS THE GREATEST HEAVY METAL BAND OF ALL-TIME. #1

CRADLE OF FILTH IS KICK*ASS*METAL’S # 1 RATED/ RANKED BAND SICNE FEBRURARY 1994.

ie the GREATEST BAND in HEAVY METAL – INTERNATIONAL Category.

For those up on HEAVY METAL, KICK*ASS*METAL readers KNOW OUR NUMBER 1 rated / ranked band in the Norway – Category is CREST OF DARKNESS, with “THE OGRESS”. And has been the NUMBER ONE HEAVY METAL album of all-time since MAY 1999. Which is a album, which may never be topped.

Auction is getting down to 5 minutes, and off to BNR pages, and as luck would have it he reads KICK*ASS monthly, Snakepit Magazine France, and has KICK*ASS*METAL’s ebay cheat sheet, of the top 100 albums of all-time, and a extented list of the greatest albums of all-time called the Sacred 700, the top 666 albums of all-time.

So you count his recommendation as a 100 out of 100, sure it raises the score, but does any one every buy albums on CD, that are going to go for over $100 dollars, with a mere score of 80%. This is why 80% are the new 100’s since 1994.

You got a few minutes left, time to make some phone calls, you get on the dude who wrote the 100%, ( he wrote the rave review because he has his old tattered vinyl and cassettes to sell, he finally got one of the top 100 albums of all-time on CD)

Still got time left so you call the dude who gave it a 1% (he tells you “oh there over-rated by KICK*ASS*METAL webZine and Sound of Death Metal ‘zine) because he knows this album rules, and want to horde 30 copies for himself.

LIKE A ACTUAL smart heavy metal fan.

So you go with the wrong advice, since you could not do research, yourself from the actual sources of the metal movement,  1981’s KICK*ASS*MONTHLY and 1991’s Sounds of Death magazine.

You lost the auction, because you decided not to fire off, a last-minute bid-snip bid.

alist_kam_993592_578855905492963_1100340068_n

sos_kam_files_10257084_728170330579737_5292882701749479413_o

Don’t worry you lost this time for $100, but when enough metaller’s who are doing research, discovers that this is a TOTAL METALLIC MOLTEN METAL masterpiece, you can try your luck when it comes around again for $200.

 

Since you aren’t up on thrash metal/ extreme metal/ true metal, and the corner stones of extreme metal. What else did you miss.

THIS LIST IS THE TOP 100 TRADITIONAL METAL ALBUMS OF ALL-TIME LIST

Abattoir * Vicious Attack

Accept * Restless And Wild

ACID * ACID

ACID * MANIAC

Agent Steel * Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis * Screams And Whispers

ANGEL DUST * Into The Dark Past

Angel Witch * Angel Witch

ANNIHILATOR * ALISION HELL

Annihilator * Never Neverland

ANTHRAX * FISTFUL OF METAL

Anvil * Metal On Metal

ANVIL * FORGED IN FIRE

Anvil * Live In Concert

Anvil * Worth The Weight

Anvil Chorus * Thought Crimes

Artillery * Fear of Tomorrow

ARTILLERY * TERROR SQUAD

Artillery * By Inheritance

ATHEIST * PIECE OF TIME

ATHEIST * UNQESTIONABLE PRESENCE

Atheist * Elements

Attacker * Battle At Helms Deep

Attacker * The Second Coming

BATHORY * BATHORY

BATHORY * THE RETURN

Black Sabbath * The Mob Rules

BLIND ILLUSION * THE SANE ASYLUM

Bloodlust * Guilty As Sin

Cage * Astronomy

Cathedral * Supernatural Birth Machine

CELTIC FROST * MORBID TALES

CELTIC FROST * EMPEROR’S RETURN

CELTIC FROST * TO MEGATHERION

Cirith Ungol * Frost and Fire

Cirith Ungol * King Of the Dead

COVEN *WITCHCRAFT REAPS MINDS AND DESTROYS SOULS

DIRECT INFLUENCE ON MERCYFUL FATE

COVEN * JINX

COVEN13 * WORSHIP NEW GODS

COVEN13 * RAGNAROK

COVEN13 * DESTINY OF THE GODS

Culprit * Guilty As Charged

Dark Age * Dark Age (Gnarly Records & RoadrunneR Records)

Dark Angel * Darkness Descends

Dark Angel * Leave Scars

DEATH DEALER * KEEPER OF THE FLAME

DEATH DEALER * JOURNEY INTO FEAR

Death * Scream Bloody Gore

Death * Leprosy

Death * Spiritual Healing

DEATH * HUMAN

DEATH * INDIVIDUAL THOUGHT PATTERNS

Death * Symbolic

Death Angel * The Ultra-Violence

Death Angel * Frolic Through The Park

DEATH ANGEL * ACT III

Death Strike * Death Strike

DEEP SWITCH * NINE INCHES OF GOD

Destruction * Infernal Overkill

DESTRUCTOR * MAXIMUM DESTRUCTION

Diamond Head * Lightning The Nations

EXCITER * HEAVY METAL MANIAC

Exciter * Violence & Force

Exciter * Exciter—Double Play Classic 1989 Megaforce/Caroline CD

EXHORDER * SLAUGHTER IN THE VATICAN

EXODUS * BONDED BY BLOOD

EXODUS * THE ULTIMATE REVENGE—COMBAT TOUR LIVE –VHS/DVI

EXODUS * PLEASURES OF THE FLESH

EXODUS * A LESSON IN VIOLENCE  COMBAT RECORDS 1991 CD

UNRELEASED STUDIO & LIVE TRACKS FEATURING ORIGINAL VOCALIST PAUL BALOFF * ULTIMATE REVENGE SOUNDBOARD SOUNDTRACK + MARCH 1986 + 3 SONG DEMO

EXODUS * ANOTHER LESSON IN VIOLENCE * LIVE 1997 CD

EXODUS * BONDED BY BALOFF * VOLVE CD

UNRELEASED STUDIO & LIVE TRACKS FEATURING ORIGINAL VOCALIST PAUL BALOFF * ULTIMATE REVENGE SOUNDBOARD SOUNDTRACK + MARCH 1986 + 3 SONG DEMO —-REMASTERED WITH BONUS TRACKS

EXUMER * POSSESSED BY FIRE

EXUMER * RISING FROM THE SEA

FORBIDDEN * FORBIDDEN EVIL

FORBIDDEN * TWISTED INTO FORM

The GATHERING * MANDYLION

The GATHERING * NIGHTTIME BIRDS

The Great Kat * Worship Me Or Die

Griffin * Flight of The Griffin

H-bomb * Attaque

Hawaii * One Nation Under Ground

HEATHEN * BREAKING THE SILENCE

HEATHEN * VICTIMS OF DECEPTION

Hellhammer * Apocalyptic Raids

HIRAX * RAGING VIOLENCE

For the CD age it was pressed as a anthology called NOT DEAD YET

HOLOCAUST * THE NIGHTCOMERS

Imagika * Imagika

Imagika * Worship

Imagika * And So It Burns

INSANITY * DEATH AFTER DEATH

IRON MAIDEN * IRON MAIDEN

IRON MAIDEN * KILLERS

IRON MAIDEN * THE NUMBER OF THE BEAST

JAG PANZER * AMPLE DESTRUCTION

JAGUAR * POWER GAMES

JUDAS PRIEST * UNLEASHED IN THE EAST

Judas Priest * British Steel

Judas Priest * Painkiller

KING DIAMOND * FATAL PORTRAIT

KING DIAMOND * ABIGAIL

KING DIAMOND * THEM

Kreator * Endless Pain

Kreator * Pleasure To Kill

Liege Lord * Master Control

Macabre * Gloom

Malediction * Condamnés

MANOWAR * BATTLE HYMNS

MANOWAR * INTO GLORY RIDE

MANOWAR * HAIL TO ENGLAND

MERCYFUL FATE * MERCYFUL FATE

EXTENED PLAY 1982 1ST PRESSING WITH WHITE BORDER

MERCYFUL FATE * MERCYFUL FATE 

EXTENED PLAY 1982 * 2ND PRESSING

MERCYFUL FATE * MELISSA * OCTOBER 31ST, 1983 MEGAFORCE/ IMPORTANT RECORDS CD 

DIFFERNT SOUND ON THE TITLE TRACK

MECYFUL FATE * MELISSA * RoadrunneR CD

MERCYFUL FATE * DON’T BREAK THE OATH

MERCYFUL FATE * CURSE OF THE PHARAOHS

1986 FANCLUB PRESSING

MERCYFUL FATE * LIVE… FROM THE DEPTHS OF HELL

1986 FANCLUB PRESSING

MERCYFUL FATE * THE BEGINNING — 1987 COMPILIATON

Tracks 1-4 are the “Self-titled Rave-On Records” EP.*Tracks 5-7 from the “Friday Rock Show” radio show / “Rave-on sessions” *Track 8 is the “Black Funeral” EP’s B-side

MERCYFUL FATE * CURSE OF THE VAMPIRE —THE RARE AND UNRELEASED. Companion piece  to “Curse of The Pharaohs LP/Picture DISC and Cassette.”

MERCYFUL FATE *IN THE SHADOWS

MEGADEATH * RUST IN PEACE

METAL CHURCH * METAL CHURCH

METALLICA * KILL ‘EM ALL

METALLICA * RIDE THE LIGHTNING

METALLICA * MASTER OF PUPPETS

METALICA * CLIFF ‘EM ALL * 1987 VHS/DVD

MORBID ANGEL * ABOMINATIONS OF DESOLATION

MORBID ANGEL * ALTARS OF MADNESS

MORBID ANGEL * BLESSED ARE THE SICK

MORBID ANGEL * DOMINATION

MORBID ANGEL * ENTANGELD IN CHOAS

Motorhead * Ace of Spade

Motorhead * Iron Fist

MOTORHEAD * NO SLEEP ‘TIL HAMMERSMITH

Motorhead * Another Perfect Day

Motorhead * No Remorse

Motorhead * Orgasmatron

Nasty Savage * Nasty Savage

NASTY SAVAGE * INDULGENCE

NERVOSA * TIME OF DEATH

NERVOSA * VICTIM OF YOURSELF

Nightmare * Astral Deliverance

Nightmare * Live Deliverance

OBITUARY * SLOWLY WE ROT

OBITUARY * CAUSE OF DEATH

Obliveon * Nemesis

ONSLAUGHT * THE FORCE

OVERKILL * FEEL THE FIRE

Oz * Fire In The Brain

OZZY OSBOURNE * BLIZZARD OF OZZ

OZZY OSBORUNE * DIARY OF A MADMAN

OZZY OSBOURNE * TRIBUTE

PAGAN ALTAR * VOLUME ONE

Pentagram * Pentagram 1985 LP

Pentagram * Day of Reckoning

Pentagram * Relentless * 1985 LP retitled / reissued 1993

Pentagram “Pentagram” reissue is retitled “Relentless” and restores the original cassette mix and running order.

Pentagram * Be Forewarned

POSSESSED * SEVEN CHURCHES

Raven * Rock Until You Drop

Raven * Wiped Out

RAVEN * ALL FOR ONE

RAVEN * LIVE AT THE INFERNO

RAZOR * EXECTIONER’S SONG

RAZOR * EVIL INVADERS

REPULSION * HORRIFIED

Riot * Fire Down Under

Riot * Thundersteel

Riot * Privilege of Power

RUSH * A FAREWELL TO KINGS

RUSH * PERMANENT WAVES

RUSH * MOVING PICTURES

RUSH * SIGNALS

RUSH * GRACE UNDER PRESSURE

RUSH * POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * TEST FOR ECHO

RUSH * DIFFERET STAGES – LIVE

SACRIFICE * TORMENT IN FIRE

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLDIERS OF MISFORTUNE

SACRFICE * APOCALYPSE INSIDE

SATAN * COURT IN THE ACT

Scorpions * Taken By Force

SEPULTURA * BENEATH THE REMAINS

Sindrome * Sindrome * CD demos

The December 1987 Demo “In The Halls of Extermination” & The December 1991 Demo “Vault of Inner Conscience” on 1 CD * Sold by The bands management in the late 1990’s

Skullview * Kings of The Universe

SLAUGHTER * STRAPPADO

SLAUTERXSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER * SHOW NO MERCY

SLAYER * HAUNTING THE CHAPEL

SLAYER * LIVE UNDEAD

SLAYER * HELL AWAITS

SLAYER * REIGN IN BLOOD

Slayer * South Of Heaven

Slayer * Seasons In The Abyss

Syris * Unseen Forces

Tank * Filth Hounds of Hades

Tank * Power of The Hunter

TANK * THIS MEANS WAR

TERRORIZER * WORLD DOWNFALL

TESTAMENT * THE LEGACY

TESTAMENT * THE NEW ORDER

TESTAMENT * PRACTICE WHAT YOU PREACH

TROUBLE * LIVE 1983 DEMO CASSETTE ALBUM

TROUBLE * TROUBLE … AKA PSALMS 9

later retitled “PSALMS 9

TROUBLE * THE SKULL

TROUBLE * RUN TO THE LIGHT

TYGERS OF PAN TANG * WILDCAT

Tygers of Pan Tang * Spellbound

Tygers of Pan Tang * Crazy Nights

Venom * Welcome To Hell

Venom * Black Metal

Venom * At War With Satan

Vi0-lence * Eternal Nightmare

Voi Vod * War And Pain

U.F.O * The Wild, The Willing, And The Innocent

Unseen Terror * Human Error

WARGASM * WHY PLAY AROUND?

WARHEAD * SPEEDWAY

WARHEAD * THE DAY AFTER

WATCHTOWER * ENERGETIC DISASSEMBLY

WATCHTOWER * CONTROL AND RESISANCE

WITCH CROSS * FIT FOR FIGHT

Zoser Mez * Vizier of Wasteland

THIS LIST IN BOLD AND ITALIC IS THE TOP 100 ALBUMS OF ALL-TIME LIST of the DEATH METAL age

Abnormality * Contaminating The Hive Mind * 2012
Acheron * Rites of The Black Mass
Annihilator * Alice in Hell
Assassin * The Upcoming Terror
Bathory * Blood Fire Death
Bathory * Under the Sign of the Black Mark
Bestial Warlust * Blood and Valour
Bloodreaping * Ignis Penumbra
Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!
Centuions Ghost * A Sign of Things To Come
Coroner * RIP
Cradle of Filth * The Principle of Evil Made Flesh
Crest of Darkness (NORWAY) * The Ogress
Crest of Darkness (NORWAY) * Project Regeneration
Crown of Thorns (Sweden) * Eternal Death
Dark Angel * Darkness Descends
Death * Scream Bloody Gore
Death Angel * The Ultra- Violence
Destruction * Infernal Overkill
Deicide * Deicide
Disiplin (NORWAY) * Anti-Life
Dismember * Like a Every Flowing Stream
Entomed * Left Hand Path
Exodus * Bonded By Blood
Exumer * Possessed By Fire
Exumer * Rising By The Sea
Fleshcrawl * Bloodred Massacre
Gravehill * Rites of the Pentagram * 2009
Hellcannon * Infected With Violence
Impiety * Skullfucking Armeggedon
Impiety Koas Kommand 696
Internal Bleeding * Vocarcious Contempt
Iperyt * Totalitarian Love Pulse * 2007
Killaman * Killman
Kings Evil * Deletion of Humanoise
Kreator * Pleasue TO Kill
Krisiun * Black Force Domain
Leviathan * The Tenth Sublevel of Suicide
Massacra (FRANCE) * Final Holocaust
Massacre * From Beyond
Metallica * Kill em All
Metallica * Ride The Lightning
Morbid Angel * Altars of Madness
Mythos * Pain Amplifier
Nercodeath * Into the Macabre
Necromessiah * Antiklerikal Terroristik Deathsquad
Nervosa (Brazil) * Victim of Yourself * 2014
Nightside * The End of Christianity
Nile * Amongst The Catacombs of Nephren Ka
Nocturnal Breed (NORWAY) * Agressor
Nocturnal Breed (NORWAY) * Fields of Rot
Nocturnus * The Key
Occult * Of Fleash and Blood
Occult * Elegy For The Weak
Pessimist * Blood For The Gods
Pestilence * Malleus Maleficarum
Possessed * Seven Churches
Onslaught * The Force
Rabelliun (BRAZIL) * Burn The Promise Land
Ritual Carnage * The Highest Law
Sabbat * (NIPPON) * Envenom
Sabbat * (NIPPON) * Envoke
Sabbat * (NIPPON) * Disembody
Sabbat * (NIPPON) *Fetishism
Sabbat * (NIPPON) *Karisma
Sabbat * (NIPPON) *Satanasword
Sabbat * (NIPPON) * Karmagmassacre
Sabbat * (NIPPON) * …And the Sabbatical Queen
Sabbat * (NIPPON) * To Praise the Sabbatical Queen
Sabbat * (NIPPON) *Sabbatrinity
Sabbat * (UNITED*KINGDOM) * History of a time to Come
Sadus * Swallowed in Black
Sepultura * Beneath The Remains
Slayer * Show No Mercy
Slayer * Haunting The Chapel
Slayer * Hell Awaits
Slayer * Live Undead
Slayer * Reign In Blood
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007
Surrender of Divinity * Oriental Hell Rhythmic
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Urgehal * Goatcraft Torment *
Warfect * Exoneration Denied * 2013
Walhalla * Firereich
Vader * The Ultimate Incantation
Vader * Litnay
Voi Vod * War and Pain
Zyklon (NORWAY) * Aeon

A Hill To Die Upon * Infinit Titanic Immortal

Abaddon Incarnate * The Last Supper * 1999
Abigor (Austria) * Fractal Procession * 2007
Abigor (Austria) * Time Is The Sulpher In the Veins of the Saint * An Excursion on Satan’s Fragmenting Principle * 2010
Abnormality * Contaminating The Hive Mind * 2012
Aborym * Fire Walk With Us * 2001
Aborym * With No Human Intervention * 2003
Abruptum (SWEDEN) * Evil Genius * 1995

Acheron * Rites of The Black Mass * 1992
Acheron * Lex Talionis * 1994
Acheron * Hail Victory * 1995
Acheron * Anti – God, Anti -Christ * 1996
Acheron * Those Who Rise * 1998
Acheron * Rebirth * 2003
Acheron * The Final Conflict * 2009
Acheron * Kult De Hasses

Aeternus * …and So The Night Became * 1998
Aeternus * Shadow of Old * 2001
Aeternus * Ascension of Terror * 2001
Aeternus * A Darker Monument * 2003
Aeternus * HeXaeon

Altar * In The Name of The Father

Amputator * DeathCult Barbaric Hell * 2007

Angelcorpse * Of Lighting and Lucifer * 2007

Arkhon Infaustus (FRANCE) * Hell Injection * 2001
Arkhon Infasstus (FRANCE) * Filth Catalyst * 2003

Anateus (FRANCE) * Blood Libels * 2006

Asphyx * THE Rack * 1991
Asphyx * Deathhammer * 2012

Atrocity * Hallucinations * 1990
Atrocity * Todessehnnsucht * 1991

Autumnal * Rise of The Raging Death

Avulsed (SPAIN) * Goresplatter Suicide * 2005

Azaghal (FINDLAND) * Of Beast and Vultures * 2002

Behemoth (POLAND) * Zos Kia Cultus * 2002
Behemoth (POLAND) * Demigod * 2004
Belphegor (Austria) * Pestapokalypse VI * 2006
Bewitched (SWEDEN) * Spritual Warfare * 2006

Blasphemophagher (Italy) * The III Command of The Absolute Choas * 2011
Bloodduster *LYNDEN NA * 2007
Bloodline * Werewolf Training * 2003
Blood Freak * Sleaze Merchants * 2003
Blood Reaping * Ignis Penumbra * 2003
Blood Ritual * Black Grimore * 2005

Body Bag * Hate Crimes * 1995
Bone Gnawer * Feast of Fleash * 2009

Carpathian Forest * Fuck You All !!!!!! Caput Tuum In Ano Est * 2006

Celebratum (NORWAY) * Mirrored Revelation * 2001
Centurions Ghost (UNITED KINGDOM) * A Sign of Things To Come * 2005

Children of Technology * Futre Decay * 2014

Cirith Gorgor (NETHERLANDS) * Unveiling The Essence * 2001

Cradle of Filth * The Principle of Evil Made Flesh * 1994
Cradle of Filth * V Empire * 1996
Cradle of Filth * Dusk…and Her Embrace * 1996
Cradle of Filth * Cruelty and The Beast * 1998
Cradle of Filth * From The Cradle To Enslave * 1999
Cradle of Filth * Midian * 2000
Cradle of Filth * Bitte Suites To Succubi * 2001
Cradle of Filth * Damnation and a Day * 2003
Cradle of Filth * Nymphetamine * 2004
Cradle of Filth * Thornography * 2006
Cradle of Filth * Godspeed on The Devil’s Thunder * *2008
Cradle of Filth * Darkly, Darkly, Venus Aversa * 2010
Cradle of Filth * Midnight On The Ladybrinth * 2012
Cradle of Filth * The Manticore and Other Horrors * 2012

Craft (SWEDEN) * Fuck The Universe * 2005
Craft (SWEDEN) * Void * 2011
Cranium (SWEDEN) * Speed Metal Slaughter * 1998
Cranium (SWEDEN) * Speed Metal Sentence * 1999
Crest of Darkness * (NORWAY) * The Ogress * May 1999

Crest of Darkness * (NORWAY) * Project Regeneration * Nov 2001

Crytopsy (CANADA) * Blasphemy Made Flesh * 1994

Deathspell Omega (FRANCE) Fas- Ite, Maledicti, in Ignem Aeternum
Deceased * Fearless Undead Machines * 1997
Deceased * Supernatural Addiction * 2000
Deeds of Flesh * Inbreeding THE Anthropophagi * 1998
Dementor (SLOVAKIA) * Enslave The Week * 2001
Der Gerwelt (RUSSIA) * Human Breed * 2003
Desaster (Germany) * Satan’s Soldiers Syndicate * 2007
Desaster (GERMANY) * The Arts of Destruction * 2012

Diabloic * Excisions of Exorcism * 2010
Displin (NORWAY) *Anti-Life * 2005

Doomstone * Those Whom Satan Hath Joined * 1994
Doomstone * Satanvoid * 2000

E-Force (CANADA) * Evil Forces * 2003

Embalming Theatre * Sweet Chainsaw Melodies * 2003

Enslaved (NORWAY) * Vikingligr Veldi * 1994
Enslaved (NORWAY) * Mardraum * 2000
Enthroned (BELGIUM) * Carnage In Worlds Below * 2002
Eskhaton * Nihilgoety * 2011

Exalted * We Are The Grim Throng * 2007
Extreme Noise Terror * Retro-bution * 1995
Extreme Noise Terror * Damage 381

Fleshcrawl (GERMANY) * As Blood Rains From The Sky…We Walk The Path of Endless Fire * 2000

Frost (UNITED KINGDOM) * Talking To God * 2004

Furbowl (SWEDEN) * Those Shredded Dreams * 1992
Furbowl (SWEDEN) * The Autum Years * 1994

Gehenna (NORWAY) * Seeing Through The Veils of Darkness * 1995
Gehenna (NORWAY) * Malice * 1996

Ghoul * Maniaxe * 2003
Ghoul * Splatterthrash * 2006

Grand Belial’s Key * Judeobeast Assassination * 2001
Gravehill * Rites of The Pentagram * 2009
Grey (FRANCE) * The First Shade of….

Gorgoroth (NORWAY) * Ad Majorem Sathanas Gloriam * 2006

Guillotine * Under The Guillotine * 2007

Harm (NORWAY) * Demonic Allegiance * 2011

Hellcannon * Infected With Violence * 2010
Hellish Crossfire *Bloodrust Scythe * 2010

Howling * A Beast Conceived * 2013

Ill-Disposed * THERE IS LIGHT (BUT IT’S NOT FOR ME) * 2011

Impaled Nazarene (FINLAND) * Pro Pratia Finlandia * 2006
Imperial Sodomy (FRANCE) * Tormenting The Pacifist * 2001
Impiety (SINGAPORE) * Skullfucking Armageddon * 1999
Impiety (SINGAPORE) * KAOS KOMMAND 696

In Memorium * From Misery…Comes Darkness * 2003
Internal Bleeding * Voracious Contempt * 1995
Internal Bleeding * The Extinction of Benevolence * 1997
Internal Bleeding * Driven To Conquer * 1999
Internal Bleeding * Onward To Mecca
Inquisition * Obscure Verses for the Multiverse * 2013

Iperyt (POLAND) * Totalitarian Love Pulse

Judas Iscariot * Heaven In Flames * 1999

Katalklysm (CANADA) * Sorcery * 1995

Kerasphorus * Cloven Hooves at the Holocaust

Killaman (SWEDEN) * KILLAMAN * 2003

Konkorha (DENMARK) * Spit of Swallow * 1995

Krisiun (BRAZIL) * Black Force Domain * 1995
Krisiun (BRAZIL) * Apocalyptic Revelation * 1998
Legion of The Damned  * Feel the Blade

M

Marduk (Sweden) * NIGHTWING * 1998
Marduk * Wormwood

Necromessiah * Antiklerical Terrorristik Death Squad
Necronomicon (CANDA) * Rise of The Elder One * 2013
Necrophobic (SWEDEN) * The Nocturnal Silence * 1993
Necrophobic (SWEDEN) * Womb of Lilithu * 2013
Nervosa * Victim of Yourself

Omission (SPAIN) * Thrash Metal Is Violence * 2009

Power Trip * Manifest Decimation * 2013

RUINS (GERMANY) * Satanic Bitchpenetraton * 2008
RUINS (GERMANY) * Chambers of Perversion * 2010
Satanikca (ITALY) * Satanikattack * 2011
Sacrilegious Impalement (FINLAND) * Cultus NEX
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Slagmaur (NORWAY) * Vov Rov Shelter * 2009

The Grotesequery * Tales of The Coffin Box
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Tormentress (Singapore) * Thrashing Disorder * 2009
Trismesisto (ITALY) * Earie Black Path * 2009
Toxic Holocaust * Hell On Earth * 2005
Toxic Holocaust * Chemistry of Consciousness * 2013

Urgehal * Goatcraft Torment

Watain (SWEDEN) * Rabid Death Curse * 2000
Watain (SWEDEN) * Casus Luciferi * 2003
Watain (Sweden) * The Wild Hunt * 2007
Warfect * Exoneration Denied * 2013

 

GOOD LUCK finding any metal publication in print who has not listed.

Cradle of Fithh “Cruelty And The Best” AS A TOP 100 TRUE METAL ALBUM OF ALL-TIME.

You can not pull the bullshit in print as you can do on-line, on the other hand, your fanzine will go bankrupt from of its incompetence.  Maybe the fish market can buy your back catalogue, for pennies on the dollar, so you can buy some cat food to eat, and maybe a dollar beer to wash it down. You tried a fanzine, it failed because the publication lacked any mention of Artillery, in top 100 albums of all-time list. Better luck next time.

sos_kam_files_10257084_728170330579737_5292882701749479413_o

crestofdarkness_the_ogress_worldsgreatest_heavy_metal_bandsince_May12th1999

cristina_scabbia_the_best-of_the_best_kick-ass-metal-files