Archives for posts with tag: top 100 heavy metal albums of all-time

Photo credit (c) (p) Carlos Arias 

 

A quick break on our new album recordings to announce awesome news: OUR DRUMMER IS THE LATEST Paiste Cymbals ARTIST!

The already traditional cymbal brand now welcomes Luana Dametto to the Paiste Family, which already has some of the biggest names in music, such as Nicko McBrain, Alex Van Halen, Dave Lombardo, Mikkey Dee, Eloy Casagrande, among others!

Luana debuts her cymbals on the recordings of Nervosa’s 3rd studio album which is happening now, and also during their upcomin

See More

A quick break on our new album recordings to announce awesome news: OUR DRUMMER IS THE LATEST Paiste Cymbals ARTIST!

The already traditional cymbal brand now welcomes Luana Dametto to the Paiste Family, which already has some of the biggest names in music, such as Nicko McBrain, Alex Van Halen, Dave Lombardo, Mikkey Dee, Eloy Casagrande, among others!

Luana debuts her cymbals on the recordings of Nervosa’s 3rd studio album which is happening now, and also during their upcoming European tour, with Venom Inc. and Suffocation, playing in 14 countries!
Congrats!

————————————————————————————

We took a break in the recording of the new album to announce an amazing news: our drummer is the newest artist of paiste cymbals!

The Veteran brand now integrates luana dametto to the family family, which already has some of the greatest names of world music, such as nicko mcbrain, Alex Van Halen, Dave Lombardo, Mikkey Dee, Eloy Casagrande, among others!

Luana debuts her dishes on the recording of the third album of nervosa that is happening now and also on the European tour in March, alongside venom inc. And suffocation, during which you will play in 14 countries!
Congratulations!

Photo: Rafael Dolinski

(PORTUGUÊS ABAIXO)

NERVOSA: RECORDINGS OF THE NEW ALBUM STARTED!

Fernanda Lira (vocal and bass), Prika Amaral (guitar and backing vocals) and Luana Dametto (drums) are already gathered in São Paulo, Brasil, for the recording of the band’s third full-length.
The chosen studio is the already renowned Family Mob Studio, where some Brazilian bands like the legendary Ratos de Porão and Andreas Kisser (Sepultura) and also international bands like Coldplay have already recorded. Other big names who also visited and rehearsed at the studio were Dave Lombardo, King Diamond and Death Dta during recent appearances in Brazil.

The production and recording is in charge of the Argentinian producer Martin Furia who worked as a sound engineer on some of Nervosa’s European tours, as well as for bands like Destruction and Flotsam & Jetsam, and in studio for Evil Invaders and Sisters of Suffocation, among others.
“I’m very excited to record with these girls I’ve known for a few years now. I want to bring all the energy and aggressiveness they have live for this studio album! ”

More details on the album will be announced in the coming weeks.
Follow the whole process through the band’s social networks:
www.facebook.com/femalethrash
www.instagram.com/nervosathrash
twitter.com/nervosathrash

Know more about Family Mob Studio:
www.familymob.com.br
www.instagram.com/familymob.studio

———————————————————————————

NERVOSA: iniciada gravação do novo álbum

Fernanda Lira (vocal e baixo), Prika Amaral (guitarra e backing vocals) e Luana Dametto (bateria) já se encontram reunidas em São Paulo para as gravações do terceiro disco da banda.
O estúdio escolhido foi o já renomado Family Mob Studio, onde já gravaram nomes nacionais como o lendário Ratos de Porão e Andreas Kisser (Sepultura) e internacionais, como o Coldplay. Também já visitaram e ensaiaram no estúdio Dave Lombardo, King Diamond e Death Dta durante recentes passagens no Brasil.

A produção e gravação fica por conta do argentino Martin Furia, técnico de som da Nervosa em algumas turnês européias, e também de bandas como Destruction e Flotsam & Jetsam, e em estúdio com Evil Invaders e Sisters of Suffocation, dentre outras.
“Estou muito entusiasmado em gravar com essas meninas que já conheço há alguns anos. Quero trazer toda a energia e agressividade que elas têm ao vivo para esse álbum de estúdio!”

Mais detalhes sobre o disco serão anunciados nas próximas semanas.
Acompanhe todo o processo pelas redes sociais da banda:
www.facebook.com/femalethrash
www.instagram.com/nervosathrash
twitter.com/nervosathrash

Conheça mais sobre o Family Mob Studio:
www.familymob.com.br
www.instagram.com/familymob.studio

 

 

 

 

 

 

Nervosa Biography 

 

All female power thrash metal trio from São Paulo, formed by Fernanda Lira (bass and vocals), Prika Amaral (guitar and backing vocals) and Luana Dametto (drums).

Despite being part of bands from different styles previously, like death metal and crossover, all members see in the compositions of Nervosa a same passion: thrash metal. With strong influences coming from bands of this genre’s classic school, the girls of the band seek to rescue the best in heavy music.

Prika Amaral started the band in February 2010, and in July 2011 Fernanda Lira took on the bass and vocals of NERVOSA, and only then, finally with the full team, the band started working as a professional band – writing songs, recording, playing shows.

In March 2012, the band released their first music video for “Masked Betrayer,” which reached the incredible mark, for a new band, of 20,000 views in just one week, prompting them to receive an Honorable Mention from YouTube, as the 17th most watched clip of musicians of the week and 55th most viewed in the month of March of that year.

Thanks to the notoriety gained through their hard work, NERVOSA in the following months, achieved a great accomplishment: the contract with the Austrian label Napalm Records, which has in their roster names like Cavalera Conspiracy, WASP, Grave Digger, Moonspell, Huntress, among many others.

Still in 2012, the band’s first record, a demo with 3 tracks, was released in Brazil on CD independently, under the title ’2012′ in August, and abroad by Napalm Records on turquoise vinyl, and by Nuclear Blast in a clear version, both under the title ‘Time Of Death’, whose cover art was designed by artist Andrei Bouzikov, who has worked with several bands previously, such as Municipal Waste.

Nervosa ends the year 2012 with a very positive balance with more than 50 concerts made around the country, among them, sharing the stage with bands like Exodus, Raven, Grave, Samael (in the festival Roça n Roll), Exumer and Artillery , among others.

After a period of exchanging drummers, the one who assumed the position in February of 2013 was Pitchu Ferraz.

Thus, the year 2013 began with a renewed vibe, and the band continued to promote their EP throughout the country, with shows in several states, and even a tour over the North and Northeast of the country, as well as sharing the stage with other great Names of the world scene such as Korzus, Ratos de Porão and also Destruction, Exciter, Blaze Bayley, Kreator, DRI And Benediction.

In 2014, the girls finished the recording of their first full lenght, titled Victim of Yourself, which had 12 tracks and whose cover was signed again by the artist Andrei Bouzikov, and the booklet was produced by the Brazilian artist Rafael Romanelli.

The album was released in March of that same year by Napalm Records in Europe and North America, and by other record companies and distributors in South America, Japan and Russia. In addition to the traditional CD format, 4 vinyl versions were also released – in black, blue, red and clear colors, distributed by Napalm Records itself and also by Nuclear Blast.

Two clips were released throughout the album’s promotion: ‘Death!’, which achieved record-breaking views among the band’s videos (over 1 million views), and ‘Into Moshpit’, a live video compilation that demonstrates all the energy of the girls in a live show.

These two singles, added to the other tracks of the album, made ‘Victim of Yourself’ reach great response from the metal audience, as well as prominence and good ratings in major magazines in the segment around the world, such as European Metal Hammer, Rock Hard , Terrorizer and Bass Guitar, the American Revolver and Guitar World and even the Japanese Burrrn, as well as the Brazilian Roadie Crew, Bass Player, Guitar Player and Modern Drummer magazines.

The good reception of the album was essential to result in a long and intense tour that lasted for the years 2014 and 2015. To promote the album in Brazil, the band played in 17 states, went through 7 countries in Latin America and made a A successful European tour with 51 shows in 60 days, including a total of 16 countries in the continent, including performances at some of Europe’s biggest summer festivals such as Summerbreeze, Brutal Assault, Metal Days, Obscene Extreme, among others.

The ‘Victim of Yourself’ promotion tour also took the band to the United States for the first time in 2016. Starting with two presentations on the already traditional ’70000 tons of metal’ cruise, leaving from Florida and going to Jamaica, the tour also passed through much of the West Coast of the country and also to the South, with more than 30 concerts from the state of Washington all the way to the state of Florida. In addition, other new territories were explored by Nervosa, such as Mexico, where the band toured for two weeks, and other locations such as Puerto Rico and Peru.

In 2016, the band recorded their new album, titled ‘Agony’. Recorded and produced in the states of California and Oregon in the United States by Brendan Duffey and mixed and mastered by thrash master Andy Classen, the album had its world premiere announced for June 3 by the Austrian label Napalm Records.

This same year was also very intense regarding shows to promote their latest album: there were more than 160 shows only in 2016.

‘Agony’ promotion tours include a European summer tour with almost 50 dates, a full month of shows on the US East Coast and also in Canada, as well as two European tours as special guests of the German band Destruction for a total of almost 60 shows, part of them being alongside the great bands Flotsam & Jetsam and Enforcer.

In 2017, who officially takes over the drums of the band is the competent Luana Dametto, who already joins it participating in the writing of the new NERVOSA album, scheduled to be out in 2018, and also facing the second leg of Agony promotion tours.

The ‘World in Agony Tour’ will be a tour that aims exploring several countries and continents around the world. So far are already announced the legs in Brazil (which has been taking place since February this year), in Mexico and Central America in May and June and in Europe during the months of July, August and part of September. In addition, plans are already being worked out to take the tour back to the US and Canada, as well as to South America and also in new territories, such as Asia.

NERVOSA is endorsed by:

– Kramer Guitars
www.kramerguitars.com

– Pedrone amplifier
www.pedroneshop.com

– DR Strings
www.drstrings.com

– Aristides Instruments
www.aristidesinstruments.com

– Ed’s MoD ShoP Custom Pedals
www.edsmodshop.com

– Romanelli Tattoo
www.facebook.com/rafaelromanelli

– Espaço Som Studio
www.espacosom.com.br

– Fernando Camargo Tattoo
http://www..myspace.com/fernandocamargo

– Contra Grife Camiseteria
www.facebook.com/contragrife

– JDuarte Design
www.jduartedesign.com

– Tiaflex Cables
www.tiaflex.com.br

NERVOSA is:

Fernanda Lira – Bass and Lead Vocals

Prika Amaral – Guitar and backing vocals

Luana Dametto – Drums

Know more about Nervosa on social medias

www.nervosaofficial.com
www.youtube.com/nervosathrash
twitter.com/nervosathrash

 Below Nervosa is on two of our TOP 100 HEAVY METAL ALBUMS OF ALL-TIME LIST. This is the Traditional Metal list, and Nervosa is also on a top 100 heavy metal list on our true metal list which the mainstream metal press calls extreme metal…that list is else where. In 2014 Nervosa won the debut and album of the year honor, and this is from  that article found elsewhere on KICK ASS METAL, this is late 2014 News article and in 2016 Nervosa won the Heavy Metal album of the year Honor, so that is 2 full-lenghts and 2 albums of the year, a debut album of the year in 2014 and all 4 releases on a our traditional and extreme metal top 100 heavy metal albums of all-time list….!!! 

KICK*ASS*METAL DEBUT ALBUM OF THE YEAR 2014

SINCE NERVOSA is the 34th Band in 1980′s / 1990′s metal band, to be the WINNER OF THE DEBUT ALBUM OF THE YEAR 2014. Here is the list of the best of the best !!!
Best debut albums

WORLD’S GREATEST DEBUT ALBUMS IN HEAVY METAL 1980-2014

2014 * Nervosa * VICTIM OF YOURSELF

2013 Latern * Below

2012 Abnormality * Contaminating the Mind Hive

2011 The Konsortium * The Konsortium

2010 Triypkon * Eparistera Daimones

2009 FEN* The Malediction Fields

2008 Hail of Bullets…of Frost and Blood

2007 Slavia * Strength and Vision

2006 Iperyt * Totalitarian Love Pulse

2005 Crucified Barbara * In Distortion we trust

2004 The Amenta * Occasus

2003 Disiplin (NORWAY) * Disiplin

2002 Bloodbath * Resurrection Through Carnage

2001 Dragonlord * Rapture

2000 Hypnosia * Extreme Hatred

1999 The Kovenant * Animatronic

1998 Ritual Carnage * The Highest Law

1997 Nocturnal Breed * Agressor

1996 Impiety * Asateerul Awaleen

1995 Usurper * Diabolosis

1994 Cradle of Filth * The Principle of Evil Made Flesh

1993 Necrophobic * The Nocturnal Silence

1992 Incantation * Onward to Gologatha

1991 Dismember * Like A Ever Flowing Stream

1990 Deicide * Deicide

1989 Morbid Angel* Altars of Madness

1988 Sabbat * History of A Time To Come

1987 Death * Scream Bloody Gore

1986 Exumer * Possessed By Fire

1985 Exodus * Bonded By Blood

1984 Bathory * Bathory

1983 Slayer * Show No Mercy

1982 Tank * Filth Hounds of Hades

1981 Venom * Welcome To Hell

1980 Tygers of Pan Tang * Wildcat

 

TOP 100 TRADITIONAL METAL ALBUMS OF ALL-TIME

Abattoir- Vicious Attack
Accept- Restless and Wild
Acid- Acid
ACID * MANIAC
ACID LIVE IN BELGIUM ’84
Agent Steel- Skeptics Apocalypse
Agent Steel * Mad Locust Rising
Anacrusis- Screams and Whispers.
ANGEL DUST- INTO THE DARK PAST
Angel Witch * Angel Witch
ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland
ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS
Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…
Anvil- Metal on Metal
ANVIL- FORGED IN FIRE
Anvil- Live in concert
Anvil-Worth the weight
ANVIL CHORUS * THOUGHT CRIMES
Anvil Chorus * The Killing Sun
Artillery * Fear Of Tomorrow
ARTILLERY * TERROR SQUAD
ARTILLERY * By Inheritance
ATHEIST- PIECE OF TIME
ATHEIST- UNQUESTIONABLE PRESENCE
Attacker-Battle at Helms Deep
Attacker-Second Coming

BATHROY * BATHORY
Bathory * The Return…
Bitch * Damnation Alley
Bitch- Be My Slave
Black Death * Black Death * Auburn Records
Black Sabbath- Mob Rules
BLIND ILLUSION- THE SANE ASYLUM
Bloodlust – Guilty As Sin
BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS
BLITZKRIEG * A TIME OF CHANGES
Bulldozer * The Day of Wrath
Bulldozer * the Final Seperation
Bulldozer * IX

CACOPHONY- SPEED METAL SYMPHONY
Cage- Astromy
Candlemass-Nightfall
Carnivore * Carnivore
Cathedral- Supernatural Birth Machine
CELTIC FROST- MORBID TALES
Celtic Frost- Emperors Return
Celtic Frost- To Mega therion
CELTIC FROST- INTO THE PANDEMONIUM
Chastain * Mystery of Illusion
Chastain * Ruler of the Wasteland
Chastain * The 7th of Never
Chastain * The Voice of Cult
Chastain- For those who Dare
CHASTAIN- IN A OUTRAGE
CORONER * RIP

CORONER * PUNISHMENT FOR DECADANCE
COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE
COVEN * Worship New Gods…Coven …aka Coven13
CIRITH UNGOL * FROST AND FIRE
CIRITH UNGOL * KING OF THE DEAD
Crimson Glory- Crimson Glory
CRYPTIC SLAUGHTER * CONVICTED
Culprit- Guilty As Charged
CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld
Dark Angel * We Have Arrived
DARK ANGEL * DARKNESS DESCENDS
DARK ANGEL * LEAVE SCARS
DEF DEALER * KEEPER OF THE FLAME
DEF DEALER * JOURNEY INTO FEAR
DEATH- SCREAM BLOODY GORE
DEATH * LEPORSY
DEATH- SPIRITUAL HEALING

DEATH- HUMAN
DEATH-INDIVIDUAL THOUGH PATTERNS
DEATH * Symbolic
Death Angel- The Ultra-Violence
DEATH ANGEL- ACT III
Death Strike-Fuckin’ Death
Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe
Ded Engine * Hot Shot
Ded Engine * Hold A Grudge
Deep Switch- Nine inches of God
DESTRUCTION- INFERNAL OVERKILL
Diamond Head * Diamond Head…1980 …aka Lightning to the Nations
Diamond Head- Lightning to the Nations
Diamond Head- Behold the Beginning
Discharge * Hear Nothing, See Nothing, Say Nothing
Dream Death- Journey Into Mystery
DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC
Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS
ECXICER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS
Exhorder- Slaughter in the Vatican
EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE
EXODUS- BONDED BY BLOOD
EXODUS- PLEASURES OF THE FLESH
EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)
EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)
Exorcist * Nightmare Theatre
EXUMER * POSSESSED BY FIRE

FATES WARNING * NIGHT ON BROKEN
Fear of God * Within The Veil
FORBIDDEN- FORBIDDEN EVIL
FORBIDDEDN * TWISTED INTO FORM

Girlschool * Hit and Run

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS
GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS
THE GREAT KAT- WORSHIP ME OR DIE!
THE GREAT KAT- BEETHOVEN ON SPEED
THE GREAT KAT- BEETHOVEN SHREDS
Griffin- Flight of the Griffin

Hawaii- One Nation Underground
HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK
HALLOWEEN- DON’T METAL WITH EVIL
Hell- Hell (1982)…Demos come with 2 disc version of 2011 CD
H-Bomb- Attaque
HEATHEN- BREAKING THE SILENCE
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now

Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller

Killer * Wall of Sound
Killer- Shock Waves
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
Massacre- From Beyond
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE

MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- NO LIFE TIL LEATHER
METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview
METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end
METALLICA* LIVE * METAL UP YOUR ASS..1983 DEMO CASSETTE
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Metallica- Creeping Death/ Jump in the Fire CD
Metallica- Master of Puppets
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron

Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE

NERVOSA  *  2012

NERVOSA *TIME OF DEATH

NERVOSA *VICTIM OF YOURSELF

NERVOSA “AGONY” 

Nightmare * Astral Deliverance
NME * UNHOLY DEATH

OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilvon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power
RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swalled in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO

SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
Saxon * Denim and Leather

Scorpions- Taken By Force
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy

THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS
THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
The Rods* Wild Dogs
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error

Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
Warlord-Deliver Us
Warlord * And The Cannons Of Desturuction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
Whiplash * Power & Pain
Whiplash * Ticket to Mayhem
Wildestarr * Arrival
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

 

 

 

Advertisements

One February 28th, 2014 The 34th Greatest Heavy Metal Debut album of all-time, in chronological order was UNLEASHED ON PLANET METAL. Debut album winners from 1980 until 2014 is 34 World-Class Heavy Metal artist. This was 1 year and 9 months ago. Since Nervosa “Victim of Yourself” is also the 2014 Heavy Metal album of the year in HEAVY METAL. We are celebrating this feat in METALLIC HISTORY, on every 28th of EVERY MONTH the offices of KICK*ASS*METAL celebrates our # 1 THRASH METAL album of the 21st Century. Nervosa Not only Made KICK*ASS*METAL’s top 100 albums of all-time in Extreme Metal, they are the ONLY 21st century heavy metal band who made our 1980’s RIFF LORD top 100 Traditional Metal albums of all-time Heavy Metal Hall of Fame, list

1535713_240390959498371_139153524042756780_n

nervosa-kam_file_10157387_625279000853881_591689557_n

nervosa_kam_file_10392385_737842639597516_3258138959404015266_n

Nervosa

Victim of Yourself

Naplam Records

100 out of 100 blood dripping skulls

Napalm Records

NPR 520

EAN UPC 8 19224 01732 5

The IMMORTALS OF METAL on this TIMELESS MASTERPIECE ARE

Fernanda Lira * World Class Vocalist / World Class Bassist

nervosa_kam_file_1399524_568616599853455_451396667_o

Prika Amaral * World Class Guitarist and World Class Background Vocalist

prika amaral_98765432_568253883223060_1130738908_kam

Pitchu Ferraz * World Class Drummer

kick_ass_metalpitchu_ferraz_2013_98765432_680116332036814_4185722326752429415_kam

Track listing *** aka *** THE SONGS YOU LOVE AND KNOW BY HEART ARE

Intro

Twisted Values

Justice Be Done

Wake up And Fight

Nasty Injury

Envious

Morbid Courage

Death!

Into Moshpit

Deep Misery

Victim of Yourself

Urano Em Nos

TWISTED VALUES

Written by : Fernanda Lira, Prika Amaral * Lyrics by : Fernanda Lira

Disorganized State, organized crime
Fear is taking over, hate being spread
fight for equality, so there’s no excuses
Not a society’s product, but their own choice’s

A Covered Up Civil War
Laws Done By Outlaws
Lives taken in vain
Terror practiced for fun

Twisted Values
Impurity
Twisted Values
Injustice

No role modles to follow, no enough laws to punish
Being evil is good, violence is usual

Killings going on and nothings done
Don’t do it by need, it’s pleasure (casuse) they’ll be free

Until when lives will be valueless?
Until when we’ll sustain them?
Until when we’ll be victim’s of their responsibilities?

Twisted Values
Impurity
Twisted Values
Corruption

JUSTICE BE DONE

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Children defenseless against cowards
Torture, abuse, harm
Leave Marks, satisfy desires
Evil pest, what is going on?

Fear
of the filthy hands
Guilt
of doing nothing
Pain
suffering in silence
Rage
they just can’t forget

Justice be Done
Silent Hurt
Justice be Done

Nowhere to run or to hide
No enough laws to punish or fight
The family won’t listen their cry
I speak in the name of this child

WAKE UP AND FIGHT
Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Wake up and fight!
Wake up and fight!

While you’re hungry-they feed their greed
While you’re homeless-they live confomfortably
While you’re dumb-they steal your money
When you’re blingd-they make fake promises

Own benefit
Death of Ethic
Power Games
Laughing at ya

The raise up the flag of fucking likes
They betray us who should be (their) allies
Submit us to their shitty corruption

People don’t know
Were on Control!

NASTY INJURY

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Prika Amaral

Time becoming a loss
Transforming every minute in pain
Won’t escape, took the blame, cold blood
Searching the unthinkable

Want to make otherwise
A moment of pure ambition
Seeking a reversal mode
You won’t get nothing from revenge

Search will be constant
Return won’t exist
Time Will be lost
No Satisfaction

Revenge!
Suffering!
Are the Consequences of his revenge
Revenge!
Suffering!
Are the principle of his defeat now
Revenge!
Suffering!
Are the values of your life now

ENVIOUS

Written by: Prika Amaral, Fernanda Lira and Fernanda Terra Lyrics by: Fernanda Lira 
Watch other thrive
Corrodes you inside
Wasted Struggle
Insult to your self-worth

You envy but you don’t recognize the hard work
My wise piece of mind-your frustration inside

Shut, move,
No words, but action
Shut, move
Pursuit satisfaction

It made me stronger
I forgave the slander
Incompetence, hate
Makes you feel this way

Trust your value
Do it better
Don’t envy other
Have your merits

MORBID COURAGE

Written by: Prika Amaral, Fernanda Lira and Fernanda Terra Lyrics by: Prika Amaral

A loser
A weak
A coward
Not able to build

Your life a mistake
Stealing won’t change you better

Inability, agony will go over you
Coward character
The hate, disgrace is what you’re gonna get

Your not free – and will never will be
Your not free – mistaken obsession

Morbid courage
Morbid and lost

Freed is lost
You choose the evil path

Your life – disgrace
You’ll pay for what you caused

DEATH!

Written by: Prika Amaral, Fernada Lira Lyrics by: Prika Amaral

The line is formed, wait for your turn, it’s going to come
Your are not alone and not going to die alone
There is a wall of people like you, afraid and crying, begging for life
Memories from your past, despair in your mind, the time has come

Bullet in the skin
Bullet in the head

Draining blood
Aiming The target
The end, the execution

Death! Death! Death!
Death! Death! Death! Shots fired

What was your sin? Why are you there? Do you deserve it?
Is if fair? Is it right? Is it wrong? What is justice?
Is it a education matter? Is it a religion matter?
Is it a culture matter?
What is going on?

INTO MOSHPIT

Written by: Fernanda Lira, Prika Amaral and Fernanda Terra Lyrics by: Fernanda Lira

Join the army, get in the violent mosh
Metal taking over
Arise your fistful of metal
Join the art of partying
Don’t care (about) the morning after

Bangers are bonded by blood
So the legacy survive
There’s no space for ignorance
There’s no malicious intent

No illusions
Grin on face
Show no mercy
This is thrash zone

The most terror squad
Is possessed by fire
Extreme aggression
Metal pandemonium

Into moshpit
Into moshpit
Into moshpit
Into moshpit

DEEP MISERY

Hunger compresses the stomach, despair increasing
Skin and bones, weakness, anemia and diseases

The cold from the ground freezes the sould
People despise deep misery
Who cares, does nothing change
Tis is no impossible for anyone

Anybody cares?
Anybody care?

The pain not to be nothing
the pain not to ben anyone anyone
The pain not to be anymore
The pain to be exclude

Deep misery
Deep misery
Deep misery
Deep misery

The pain of hunger is not a reason
People pretend not to see
Who care, dones not contribute
Any you can be in this situation

Repeat chorus

A bother of a hard ground bring pain
People ignore what they see
Who cares, doesn’t really help others
This can not happen to you, you are not free

Anybody cares?
Anybody cares?

VICTIM OF YOURSELF
Lyrics by: Fernanda Lira

The real you isn’t what you show
Your Not authentic
Blame others for your flaws
It is easier than admitting them

A lack inside, hidden by pride
Victim’s the hurt child lying inside

CHORUS

Victim of
Victim of yourself
Victim of
Victim of yourself

It is the only way to get your need’s satisfaction
It is the only way you’ll get attention
It is the only way you’ll deserve compassion
It is the only way you can fell you’re special

REPEAT CHORUS

You think you’re always right
Never Swallow your pride
Don’t admit your wrong
Hurt the ones who love you

REPEAT CHORUS

Created a safe, lunatic world to run from yourself
Afraid, you know you’ll be alone when truth overcome this lies

(Your) freak attitudes will come back to you
Don’t say you got nothing to do with the disgrace

REPEAT CHORUS

It is the only way (you) play the kid forever
It is the only way you won’t admit your shallow
But beware you’re creating your own prison
You’ll only become crazy, faker and alone

REPEAT CHORUS

URANIO EM NOS
Lyrics: By Prika Amaral

Condenados a morte
Condenados ao cancer
Devstaco atomica
Invadindo o nosso sangue

Uranio em nos
Uranio em nos
Uranio em nos

Uranio em nos
Uranio em nos
Uranio em nos

Fukushima
Chernobil
Tokaimura

Uranio em nos
Uranio em nos
Uranio em nos

Uranio em nos
Uranio em nos
Uranio em nos

Fukushima
Chernobil
Tokaimura

After a short intro entitled Intro and it starts of with LOUD cracking of thunder lighting and a creaking gate, and machine gun fire, and has a totally ominous vibe, that every fan of metal should be able to enjoy and notice the screams in the background, and the RIFF @ the 56 second mark displays why Prika Amaral is KICK*ASS*METALS favorite guitar player who was voted # 20 world-wide of all time, as the greatest guitarist in not only traditional metal but true metal, what later became known as extreme metal. This piece of music from 56 – 2:00 minutes mark is totally mind-blowing and jaw dropping, and a sight to behold.

Twisted Values is up first and this song is a perfect example why Prika Amaral is a top 20 ranked / rated Guitarist of all time With KICK*ASS*METAL and it subsidiary the KICK*ASS*METAL heavy metal hall of fame.

Prika Starts the proceeding with one of the most unique guitar tones I have heard in a longtime.

And a 54 second in Nervosa demonstrates why they are one of the most original and most important bands of the decade of 2010 and of all time.

By 229 Prika Amaral executes a rather awesome guitar solo.

Justice Be Done starts of with a rather unique riff and the song builds up nicely then around the 33 second mark the Nervosa trade mark sound is in full effect. Around the 108 mark excellent vocals provide by BOTH Fernanda Lira, and Prika Amaral. The solo @ the 140 mark will have your jaw on the floor and ends around the 2 minute mark. Fernada Lira sounds unreal on this one, make Fernada Lira the most magnificent most original metal vocalist of the decade 2010 and of all time

Wake Up and Fight is up next by the tome of 1 minute in the Prika Amaral guitar tone really gets to shine. Lots of genius to the songwriting on the music on this song at this point. Fernanada Lira really shines as a world-class vocalist on this song. The solo at the 245 mark is rather breath-taking and will send chills up and down your spine. This song is a total metal CRUNCHER.

Nasty Injury starts off with the one-of-kind guitar tone of Prika Amaral and around the 40 second mark Nervosa gets into high Nervosa thrash gear before the two-minute mark Prika Amaral does some excellent riff work then around the 2:10 mark some excellent riff and rhythm work is excecuted by Prika Amaral. The solo @ the 2:20 – 2:27 mark is totally well written and executed by World Class Guitarist Prika Amaral. And the rhythm section work by Fernanda Lira and Pitch Ferraz is totally mind blowning a perfect in all songwriting aspect. The songs main riff is used throughout the 3 minutes mark

Envious is up next. The Solo at the 2:14 mark is executed very well and demonstrates why Prika Amaral is a top rated in the top 20 of all time at kick ass metal. And Fernada Lira does some world-class bass work @ the 2:20 mark. Then @ the 2:26 mark Prika Amaral writes one of the most head banging riffs of the 21st century. The guitar tone of Prika Amaral that I love the most is on display @ the 2:40 mark. The song picks up pace then @ the 3:40 mark the song down shift into bone cruching metal style, the kind of songwriting that is perfect for head banging.

Morbid Courage is up next, and starts of Prika Amaral’s signature one-of-a-kind guitar tone. And has an excellent song build up in terms of intensity and heaviness in the fist minutes. Morbid Courage has excellent Lira/ Amaral vocal exchanges in the 1 and a half-minute mark. There is a perfect example of Pitchu Ferraz world clas drumming style @ the 1:50-1:58 mark. @ the 1:58 mark the song downs shifts for an excellent Prika Amaral solo, @ the 2:05 second mark.

Death! is up next and is one of the Greatest, written Metallic songs of all time. Prika Amaral displays every aspect of her unique and original style. I have watched the legendary video for over 7, 899 times by now since it was released around a month ago. The guitar solo starts @ the 1:22 mark and is well written and executed perfectly by metal axepert Prika Amaral. And last to the 1:54 mark. @ the 2 minute mark, the song is totally in the pocket, At the 3;00 minutes mark the Prika Amaral one-of-a-kind guitar tone is one display again in all its metallic glory.

THE GUITAR SOLO on DEATH! is one of KICK*ASS*METAL’S personal favorites of all time. Our jaws were on the floor on this one. 100% world-class dedication to her instrument.

Into Moshpit is up next and @ the 40 second mark, once can hear a totally unique and original riff executed by Prika Amaral. The guitar work provide by Prika Amaral in the 1st minute of this song can only be called original and world-class, and is provides total Nervosa thrash metal evocation. @ the 1:07 mark there is a totally KICK*ASS*METAL riff written and executed by Prika Amaral, it is because of guitar work like this, that Prika Amaral will forever be remembered as the most important, original, and magnificent guitarist of the 21st Century. Nervosa is not retro-this or retro-that, but a band that will survive the test of time. I am totally addicted to this song, because of Prika Amaral awesome guitar tones. The solo is @ the 3:14 mark, and is pretty mind-blowing and pretty stellar and world-class

Vicitm of Yourself is up next. And starts of with a totally original riff a PRIKA AMARAL riff, you can tell in a micro-second who Prika Amaral is over the other 92, 999 guitarist who also play metal. What one notices immediately about Prika Amaral is that Prika is a one-of-a-kind and a true original. @ The 48 second mark a killer song writing part takes place. Victim of Yourself the song, has one of the greatest riffs not just of the decade 2010, but of all time.

Uranio Em Nos…aka via translation means something similar to “Uranium in” * And this song starts with an AIR RAID siren. And that is just songwriting genius. The CD’s closer has a lot of excellent metal vibes because it is sung in Nervosa native language giving the song a nice personalized aspect from the songwriters point of view. World Class job on this song and the whole album.

I love Nervosa

and

I am a NERVOSA-thrasher 4 life !!!!!!

The total time for the debut album of the year 2014 is

45 minutes and 41 seconds

Japanese Pressing of Nervosa “Victim of Yourself” released March*19*2014

kam_file_nervosa_1512439_413322695488486_6113501377910927758_n

NERVOSA (GODS)

VICTIM OF YOURSELF

NAPALM RECORDS

100 out of 100 blood dripping skulls

FEB 28, 2014

KICK*ASS*METAL DEBUT ALBUM OF THE YEAR 2014

SINCE NERVOSA is the 34th Band in 1980′s / 1990′s metal band, to be the WINNER OF THE DEBUT ALBUM OF THE YEAR 2014. Here is the list of the best of the best !!!
Best debut albums

WORLD’S GREATEST DEBUT ALBUMS IN HEAVY METAL 1980-2014

2014 * Nervosa * VICTIM OF YOURSELF

2013 Latern * Below

2012 Abnormality * Contaminating the Mind Hive

2011 The Konsortium * The Konsortium

2010 Triypkon * Eparistera Daimones

2009 FEN* The Malediction Fields

2008 Hail of Bullets…of Frost and Blood

2007 Slavia * Strength and Vision

2006 Iperyt * Totalitarian Love Pulse

2005 Crucified Barbara * In Distortion we trust

2004 The Amenta * Occasus

2003 Disiplin (NORWAY) * Disiplin

2002 Bloodbath * Resurrection Through Carnage

2001 Dragonlord * Rapture

2000 Hypnosia * Extreme Hatred

1999 The Kovenant * Animatronic

1998 Ritual Carnage * The Highest Law

1997 Nocturnal Breed * Agressor

1996 Impiety * Asateerul Awaleen

1995 Usurper * Diabolosis

1994 Cradle of Filth * The Principle of Evil Made Flesh

1993 Necrophobic * The Nocturnal Silence

1992 Incantation * Onward to Gologatha

1991 Dismember * Like A Ever Flowing Stream

1990 Deicide * Deicide

1989 Morbid Angel* Altars of Madness

1988 Sabbat * History of A Time To Come

1987 Death * Scream Bloody Gore

1986 Exumer * Possessed By Fire

1985 Exodus * Bonded By Blood

1984 Bathory * Bathory

1983 Slayer * Show No Mercy

1982 Tank * Filth Hounds of Hades

1981 Venom * Welcome To Hell

1980 Tygers of Pan Tang * Wildcat

TOP 100 TRADITIONAL METAL ALBUMS OF ALL-TIME

Abattoir- Vicious Attack
Accept- Restless and Wild
Acid- Acid
ACID * MANIAC
ACID LIVE IN BELGIUM ’84
Agent Steel- Skeptics Apocalypse
Agent Steel * Mad Locust Rising
Anacrusis- Screams and Whispers.
ANGEL DUST- INTO THE DARK PAST
Angel Witch * Angel Witch
ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland
ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS
Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…
Anvil- Metal on Metal
ANVIL- FORGED IN FIRE
Anvil- Live in concert
Anvil-Worth the weight
ANVIL CHORUS * THOUGHT CRIMES
Anvil Chorus * The Killing Sun
Artillery * Fear Of Tomorrow
ARTILLERY * TERROR SQUAD
ARTILLERY * By Inheritance
ATHEIST- PIECE OF TIME
ATHEIST- UNQUESTIONABLE PRESENCE
Attacker-Battle at Helms Deep
Attacker-Second Coming

BATHROY * BATHORY
Bathory * The Return…
Bitch * Damnation Alley
Bitch- Be My Slave
Black Death * Black Death * Auburn Records
Black Sabbath- Mob Rules
BLIND ILLUSION- THE SANE ASYLUM
Bloodlust – Guilty As Sin
BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS
BLITZKRIEG * A TIME OF CHANGES
Bulldozer * The Day of Wrath
Bulldozer * the Final Seperation
Bulldozer * IX

CACOPHONY- SPEED METAL SYMPHONY
Cage- Astromy
Candlemass-Nightfall
Carnivore * Carnivore
Cathedral- Supernatural Birth Machine
CELTIC FROST- MORBID TALES
Celtic Frost- Emperors Return
Celtic Frost- To Mega therion
CELTIC FROST- INTO THE PANDEMONIUM
Chastain * Mystery of Illusion
Chastain * Ruler of the Wasteland
Chastain * The 7th of Never
Chastain * The Voice of Cult
Chastain- For those who Dare
CHASTAIN- IN A OUTRAGE
CORONER * RIP

CORONER * PUNISHMENT FOR DECADANCE
COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE
COVEN * Worship New Gods…Coven …aka Coven13
CIRITH UNGOL * FROST AND FIRE
CIRITH UNGOL * KING OF THE DEAD
Crimson Glory- Crimson Glory
CRYPTIC SLAUGHTER * CONVICTED
Culprit- Guilty As Charged
CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld
Dark Angel * We Have Arrived
DARK ANGEL * DARKNESS DESCENDS
DARK ANGEL * LEAVE SCARS
DEF DEALER * KEEPER OF THE FLAME
DEF DEALER * JOURNEY INTO FEAR
DEATH- SCREAM BLOODY GORE
DEATH * LEPORSY
DEATH- SPIRITUAL HEALING

DEATH- HUMAN
DEATH-INDIVIDUAL THOUGH PATTERNS
DEATH * Symbolic
Death Angel- The Ultra-Violence
DEATH ANGEL- ACT III
Death Strike-Fuckin’ Death
Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe
Ded Engine * Hot Shot
Ded Engine * Hold A Grudge
Deep Switch- Nine inches of God
DESTRUCTION- INFERNAL OVERKILL
Diamond Head * Diamond Head…1980 …aka Lightning to the Nations
Diamond Head- Lightning to the Nations
Diamond Head- Behold the Beginning
Discharge * Hear Nothing, See Nothing, Say Nothing
Dream Death- Journey Into Mystery
DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC
Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS
ECXICER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS
Exhorder- Slaughter in the Vatican
EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE
EXODUS- BONDED BY BLOOD
EXODUS- PLEASURES OF THE FLESH
EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)
EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)
Exorcist * Nightmare Theatre
EXUMER * POSSESSED BY FIRE

FATES WARNING * NIGHT ON BROKEN
Fear of God * Within The Veil
FORBIDDEN- FORBIDDEN EVIL
FORBIDDEDN * TWISTED INTO FORM

Girlschool * Hit and Run

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS
GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS
THE GREAT KAT- WORSHIP ME OR DIE!
THE GREAT KAT- BEETHOVEN ON SPEED
THE GREAT KAT- BEETHOVEN SHREDS
Griffin- Flight of the Griffin

Hawaii- One Nation Underground
HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK
HALLOWEEN- DON’T METAL WITH EVIL
Hell- Hell (1982)…Demos come with 2 disc version of 2011 CD
H-Bomb- Attaque
HEATHEN- BREAKING THE SILENCE
HEATHEN- VICTIMS OF DECEPTION
HEATHEN-RECOVERED
HIRAX- RAGING VIOLENCE
HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD
HOLOCAUST- THE NIGHTCOMERS
Holy Moses * The New Machine of Lichtenstien
Holy Moses * Strength, Will, Power, Passion
Holy Moses * In the Power of Now

Imagika * Imagika
Imagika * Worship
IMAGIKA * And So it Burns
Infernal Majesty * None Shall Defy
Insanity- Death after Death
IRON MAIDEN- IRON MAIDEN
IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games
JAG PANZER- AMPLE DESTRUCTION
Judas Priest * Killing Machine
Judas Priest * Hellbent for Leather * aka Killing Machine
JUDAS PREIST * UNLEASHED IN THE EAST
Judas Priest- British Steel
Judas Priest- Painkiller

Killer * Wall of Sound
Killer- Shock Waves
King Diamond-Fatal Portrait
King Diamond- Abigail
King Diamond- Them
Kreator- Endless Pain
Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom
Malediction- Condamnes
Manowar * Battle Hymns
MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS
MANOWAR * HAIL TO ENGLAND
Massacre- From Beyond
MASTER- MASTER
MASTER- 1985 ALBUM UNRELEASED
MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album
Medieval- ALL KNOBS TO THE RIGHT
MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP
MEDIEVAL- MEDIEVAL KILLS
MEGADETH- RUST IN PEACE

MERCYFUL FATE- 1982 EP
MERCYFUL FATE- MELISSA
MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS
MERCYFUL FATE- THE BEGINNING
MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS
METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP
METALLICA- NO LIFE TIL LEATHER
METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview
METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end
METALLICA* LIVE * METAL UP YOUR ASS..1983 DEMO CASSETTE
METALLICA- KILL EM ALL * MEGAFORCE RECORDS
Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS
Metallica- Creeping Death/ Jump in the Fire CD
Metallica- Master of Puppets
Morbid Angel- ABOMINATIONS OF DESOLATION
MORBID ANGEL- ALTARS OF MADNESS
MORBID ANGEL BLESSED ARE THE SICK
MORBID ANGEL * COVENANT
MORDBID ANGEL * DOMINATION
MORBID ANGEL* ENTANGLED IN CHAOS
Motorhead- Ace of Spades
MOTORHEAD- NO SLEEP TIL HAMMERSMITH
Motorhead * Iron Fist
Motorhead * Another Perfect Day
Motorhead * No Remorse
Motorhead * Orgasmatron

Nasty Savage- Nasty Savage
NASTY SAVAGE- INDULGENCE

NERVOSA (BRAZIL) *TIME OF DEATH

NERVOSA (BRAZIL) *VICTIM OF YOURSELF

Nightmare * Astral Deliverance
NME * UNHOLY DEATH

OBITUARY * SLOWLY WE ROT
OBITUARY * Cause of Death
Obilvon * From this Day Forward
Obliveon * Nemesis
ONSLAUGHT- THE FORCE
Onslaught * Power From Hell * 1987 Combat Records Version
Original Sin * Sin Will Find You Out
OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS
OZ- Fire in the Brain
OZ – III Warning
Ozzy Osbourne- Blizzard of Ozz
Ozzy Osbourne-Diary of a Madman
Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette
Pagan Altar- Pagan Altar Volume 1
PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1
PILE DRIVER- METAL INQUISITION
PILE DRIVER * STAY UGLY
Pentagram- Pentagram
Pentagram- Day of Reckoning
Pentagram * Relentless 1985 debut Retitled
Pentagram- Be forewarned
POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop
RAVEN * Wiped Out
RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS
RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS
RAZOR- EXECUTIONERS SONG
RAZOR- EVIL INVADERS
REPULSION * SLAUGHTER OF THE INNOCENT
REPULSION – HORRIFIED
Riot- Fire Down Under
Riot- Thunder Steel
Riot- Privilege of Power
RUSH * A FARWELL TO KINGS
RUSH * PEMANENT WAVES
RUSH- MOVING PICTURES
RUSH * EXIT…STAGE LEFT
RUSH- SIGNALS
RUSH- GRACE UNDER PRESSURE
RUSH- POWER WINDOWS
RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS
RUSH * PRESTO
RUSH * CHRONICLES
RUSH * TEST FOR ECHO
RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME
SABBAT ( NIPPON) * ENVENOM
SABBAT ( NIPPON) * EVOKE
SABBAT ( NIPPON) * DISEMBODY
Sadus * Illusions
Sadus * Chemical Exposure…aka Illusions
Sadus * Swalled in Black
SADUS * A VISION OF MISERY
SATAN * INTO THE FIRE * 1982 CASSETTE DEMO

SATAN- COURT IN THE ACT
SAVATAGE * Sirens
SAVATAGE * The Dungeons are Calling
Saxon * Denim and Leather

Scorpions- Taken By Force
SACRIFICE- Torment in Fire
SACRIFICE * FORWARD TO TERMINATION
SACRIFICE * SOLIDERS OF MISFORTUNE
SACRIFICE * APOCALYPSE INSIDE
SEPULTURA- BENEATH THE REMAINS
Skullview- Kings of the Universe
Sindrome- Sindrome (2 demos on CD)
SLAUGHTER- STRAPPADO
SLAUTER XSTROYES * WINTERKILL
SLAUTER XSTROYES * FREE THE BEAST
SLAYER- SHOW NO MERCY
SLAYER- HAUNTING THE CHAPEL
SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS
Slayer- Reign in Blood
SODOM * IN THE SIGN OF EVIL
SODOM * OBSESSED BY CRUELTY
STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades
Tank- Power of the Hunter
TANK- THIS MEANS WAR
TERRORIZER-WORLD DOWNFALL
Testament- The Legacy

THE GATHERING * MANDYLION
THE GATHERING * NIGHTTIME BIRDS
THE MENTORS * Live at the Whiskey
THE MENTORS * YOU AXED FOR IT
THE MENTORS * Up the Dose
The Rods* Wild Dogs
THRUST * Fist Held High
TROUBLE * LIVE…. 1983 CASSETTE
TROUBLE- PSALMS 9
TROUBLE * THE SKULL
TYGERS OF PAN TANG- WILD CAT
Tygers of Pan Tang- Spell Bound
TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent
Unseen Terror- Human Error

Vainglory * Vainglory
Venom- Welcome to Hell
Venom- Black Metal
Venom * At War with Satan
Vermefug * Wet Nightmare
VICIOUS RUMORS * Soldiers of the Night
VICIOUS RUMORS * Digital Dictator
VIO-LENCE * ETERNAL NIGHTMARE
Voi Vod- War and Pain
Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?
Warfare * Pure Filth
WARFARE-METAL ANARCHY
Warfare * Mayhem Fucking Mayhem
Warlock * Burning The Witches
Warlock * Hellbound
Warlock * True As Steel
Warlord-Deliver Us
Warlord * And The Cannons Of Desturuction Have Begun
Warlord * Thy Kingdom Come * 1st EP and LP on CD
Warhead * Speedy Way
WARHEAD- THE DAY AFTER
Warning- Aftermath
WATCHTOWER- ENERGETIC DISASSEMBLY
Watchtower * Control and Resistance
Whiplash * Power & Pain
Whiplash * Ticket to Mayhem
Wildestarr * Arrival
WITCHCROSS- FIT FOR FIGHT
WITCHFINDER GENERAL- DEATH PENALTY
WITCHFINDER GENERAL- FRIENDS OF HELL
Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

TOP 100 albums of all time NERVOSA “VICTIM OF YOURSELF”

Abnormality * Contaminating The Hive Mind * 2012
Acheron * Rites of The Black Mass
Annihilator * Alice in Hell
Assassin * The Upcoming Terror
Bathory * Blood Fire Death
Bathory * Under the Sign of the Black Mark
Bestial Warlust * Blood and Valour
Bloodreaping * Ignis Penumbra
Carpathian Forest (NORWAY) * FUCK YOU ALL !!!!!!!
Centuions Ghost * A Sign of Things To Come
Coroner * RIP
Cradle of Filth * The Principle of Evil Made Flesh
Crest of Darkness* Sinister Scenerio
Crest of Darkness* The Ogress
Crest of Darkness * Project Regeneration
Crest of Darkness * Evil Knows Evil
Crest of Darkness* Give Us Power To Do Your Evil
Crest of Darkness* In The Presence of Death
Crown of Thorns (Sweden) * Eternal Death
Dark Angel * Darkness Descends
Death * Scream Bloody Gore
Death Angel * The Ultra- Violence
Destruction * Infernal Overkill
Deicide * Deicide
Disiplin (NORWAY) * Anti-Life
Dismember * Like a Every Flowing Stream
Entomed * Left Hand Path
Exodus * Bonded By Blood
Exumer * Possessed By Fire
Exumer * Rising By The Sea
Fleshcrawl * Bloodred Massacre
Gravehill * Rites of the Pentagram * 2009
Hellcannon * Infected With Violence
Impiety * Skullfucking Armeggedon
Impiety Koas Kommand 696
Internal Bleeding * Vocarcious Contempt
Iperyt * Totalitarian Love Pulse * 2007
Killaman * Killman
Kings Evil * Deletion of Humanoise
Kreator * Pleasue TO Kill
Krisiun * Black Force Domain
Leviathan * The Tenth Sublevel of Suicide
Massacra (FRANCE) * Final Holocaust
Massacre * From Beyond
Metallica * Kill em All
Metallica * Ride The Lightning
Morbid Angel * Altars of Madness
Mythos * Pain Amplifier
Nercodeath * Into the Macabre
Necromessiah * Antiklerikal Terroristik Deathsquad
Nervosa (Brazil) * Victim of Yourself * 2014

Nightside * The End of Christianity
Nile * Amongst The Catacombs of Nephren Ka
Nocturnal Breed (NORWAY) * Agressor
Nocturnal Breed (NORWAY) * Fields of Rot
Nocturnus * The Key
Occult * Of Fleash and Blood
Occult * Elegy For The Weak
Pessimist * Blood For The Gods
Pestilence * Malleus Maleficarum
Possessed * Seven Churches
Onslaught * The Force
Rabelliun (BRAZIL) * Burn The Promise Land
Ritual Carnage * The Highest Law
Sabbat * (NIPPON) * Envenom
Sabbat * (NIPPON) * Envoke
Sabbat * (NIPPON) * Disembody
Sabbat * (NIPPON) *Fetishism
Sabbat * (NIPPON) *Karisma
Sabbat * (NIPPON) *Satanasword
Sabbat * (NIPPON) * Karmagmassacre
Sabbat * (NIPPON) * …And the Sabbatical Queen
Sabbat * (NIPPON) * To Praise the Sabbatical Queen
Sabbat * (NIPPON) *Sabbatrinity
Sabbat * (UNITED*KINGDOM) * History of a time to Come
Sadus * Swallowed in Black
Sepultura * Beneath The Remains
Slayer * Show No Mercy
Slayer * Haunting The Chapel
Slayer * Hell Awaits
Slayer * Live Undead
Slayer * Reign In Blood
Sinners Burn (Sweden) * Insanity Warmachine * 2010
Sodomizer (Brazil) * The Death Shall Rise To Kill * 2007
Surrender of Divinity * Oriental Hell Rhythmic
The Monolith Deathcult (Netherlands) * Tetragrammaton * 2013
Urgehal * Goatcraft Torment *
Warfect * Exoneration Denied * 2013
Walhalla * Firereich
Vader * The Ultimate Incantation
Vader * Litnay
Voi Vod * War and Pain
Zyklon (NORWAY) * Aeon

NERVOSA rakings at KICK*ASS*METAL ARE Worlds greatest thrash metal band of the 21st century NUMBER 1.

Our 34th annual debut album of the year winner 2014.

Top 20 Worlds greatest metal bands of all-time. Traditional and True metal.

Top 10 album of 2014, in over all category. This is what KICK*ASS*METAL knows over the other publications.

One day they will catch up to us.

NERVOSA are KICK*ASS*METAL heavy metal hall of fame member since March 2012.

nervosarulesplanetmetal_97643494237415_n

 

10620265_734827623232351_3480152283717759195_o

10408520_734828329898947_1293490584048797938_n

1272397_734826616565785_361712918841447172_o

nervosaheavymetalhalloffameliveinheadbangingacitonmetaldays98578i5644prikaamaralkramerworldclassgutiartist985795756a123prikaamaraltop20heavymetalguitaristofall-time98956784423prikaamaralworldclassguitaristnervosaheavymetalhalloffame9859864prikamaralworldclassguitaristnervosafame9895846nervosathefourhorsemenoftheapocalypse21stcentury987657846746374436347756767prikamaralnervosamarch2012heavymetalhalloffamemember2012199999765733nervosakickassmetalhallofame2012976473nervosarulesplanetmetal_9978957969709258122606873_nnervosarulesprikarules999757554516262278_nnervosarulesplanetmetal_9857674235963160940_opitchuferraz_kickassmetal_nervosalegend_987987_9999nervosafernadanlira_9967306_nnervosa_allfemalethrashmetalband_brazil_97846876355745563nervosa_kam_file_nervosa_rules_1148950_531206796927769_2106085976_nnervosa_kam_file_1150286_619439738104474_2079333222_nnervosa_kam_file_1525388_619439784771136_2028130789_nnervosa_kam_file_48076_619439758104472_1259539460_nnervosa_kam_file_1465351_619439798104468_1374313443_nnervosa_kam_file__kam9_539232_619439734771141_1985217046_nkam_file_nervosa_1175474_619439841437797_561048333_nnervosa_kam_file_nervosa1982362_619439831437798_629108958_nnervosa-kam-file_prika_amaral-headbanging-action_482404_561190117262770_797360577_nnervosa_kam_file_illovenervosa_542222_533645260017256_1720890417_nnervosa_kam_file_1554531_654628311252283_389711595090418296_nNervosastudio_9768967878046067_nnervosa_brazil_978768956nervosarulesplanetmetal_97865371287268840_n

 

http://www.youtube.com/watch?v=45nftQN0IoI

prikaamaraltop20heavymetalguitaristofall-time98956784423

Ebay http://www.ebay.com/usr/countbloodwyn

Witchcross practice went incredible tonight and we polished the new album material even more! Killer news!

Next studio date to finish the album-early MARCH!!

Also we are super psyched to announce we will be joining the killer band Vatican on May 11th in Akron, Ohio at The Empire club on a major show, soon to be announced and official flier soon posted!!!

Our new album “Cauldron In Satan’s Shadow”, will be released with our main German label, Mighty Monster Federation/Battle Cry Records and it will be out by May of this year 2018!

In other kick ass news, a prominent Swedish vinyl label wants to reissue our debut 1993 remastered self-titled album Witchcross on vinyl very soon limited edition!!!

We also have more plans to not only play bigger local shows, but get the hell out of town and hit some far away places this year!!! Hails to all of our good friends and support team and especially my wife who is so awesome and supportive. Especially thanks to those whose offer us more out of town gig dates!!!

This is the year of the Witch..Witchcross finally begins the official studio recording session of our new album “Cauldron In Satan’s Shadow” !!! This last Friday night we finished nailing the last song “Cathedral Of Blood”, to join other future classics like “Virgin Among The Living Dead”, “The Jinn”, “Cauldron In Satan’s Shadow”, “Of The Dead”, “Spells Of Mephistopheles”, “The Crystal Skull”, “Vengeance Of The Count”, and many more, with Dereck Anderson(my guitarist) really impressing us all with his multi-track digital demoing of our new songs.

I am so excited I could scream!! This new album is most certainly the most evil and heaviest Witchcross album ever, but also has some really doomy flashback style throwback to the 70’s style songs too!

It still has a base of our vintage 70’s Black Sabbath/Coven/Ozzy/Witchfinder General/Pentagram/Trouble-DOOM sound but is laced with some truly old school 80’s Mercyful Fate/King Diamond style speedier thrashy technical power metal infused to a metallic volcano of crushing thunder.

I feel that we have bridged the gap beautifully between what we did in the early days and what I did later in Ravensthorn. This album, I have to say is even better than any past release I have sang on in any band I have ever sang with and Dereck Anderson -guitar, Gary Pedersoli-drums, and Roger Massey-bass, are playing the best they ever have, truly progressing as musicians in a very impressive way!

I also have to once again thank Richard Dean for the incredible album cover which will be unveiled soon!

I hope it doesn’t get banned from Facebook for nudity(haha).

The cover art has been done for a year now, but I have kept it under wraps. The art depicts three beautiful sexy naked women witches standing around a cauldron with the Devil embracing them from the backside in the open forest in front of a blazing fire performing Satanic Black Magick Witchcraft rituals. Anyway, once the tracks are all layed down and mixed and mastered by the end of January, it goes to Mighty Monster Federation Records/Battle Cry-Germany and then gets pressed up. Hails to Sasch Machyne . By some time in March it will be out! It will be for sale worldwide through both their sites and on my official Ebay http://www.ebay.com/usr/countbloodwyn

 

 

 

Below are rePrints of previous WITCHCROSS writeUps, found elsewhere on KICK ASS METAL webZine…..Witchcross is on a couple of top 100/top 150 list the first one is the Traditional Metal List…..It has been our opinion since 1983 That Trouble/ Black Sabbath are the heaviest bands around with a natural metal aesthetic. This is our 1983 attitude, but of course we caught the death metal bug in 1990 like the rest of the metal media, those list are elsewhere, since the essence is a different vibes and guitar tones !!!!

 

 

 

Coven

http://www.ebay.com/usr/cyberstarfashion

Witchcross

https://www.ebay.com/sch/countbloodwyn/

 

WITCHCROSS BIO

 

Witchcross is a long running classic doom metal band from the Chicago area that have been putting on infamously macabre Horror Doom Metal shows for two decades, and whom lead singer Count William Jannusch, also known from another horror metal band, Ravensthorn, originated from and once again is focused more than ever on. Currently they are releasing the very Horror and Occult based “Crypt of the Undead” album(2015), but their history is very fascinating.

Nocturnal Doom was a band formed by lead vocalist/song writer Count William Jannusch in 1987, at the age of fifteen. The line-up changed several times before lead guitarist Dereck Anderson joined and the band recorded the “Shades Of Despair” album in 1991 with Dan Lamb-drums, and Gary Oakley-bass. After gigging all over Chicago and Indiana, playing all age metal clubs and roller rinks, the band developed a strong following. Soon problems with the line-up began again, and Dereck and Bill decided to hire a new drummer and bassist.

Soon after, the band recruited drummer Gary Pedersoli and bassist Roger Massey in the Summer of 1992, and the band changed their name to Witchcross. By the end of the year, they had a whole albums’ worth of original material and were also playing a catalogue of Ozzy era Black Sabbath classics live too.

In 1993, Witchcross recorded their debut self- titled album in a local college recording studio and heavily released it on professionally printed cassettes and later cds. Then heavy live concert gigging began again.

Over the years the band continued to do shows all over the Chicago,IL. and Indiana area. Band members also split into other band projects over the years, while still regrouping to perform with Witchcross. Count William Jannusch did Ravensthorn(who went on to release three albums- “House Of The Damned”(2002-now currently re-released as a remastered edition cd-2015), “Hauntings And Possessions”(2004-Hellion Records-Germany(Hellion Records.de)-followed by a four day stay overseas for a two date festival concert performance in Germany in 2005), and “Horrors Of The Black Mass”(2012) –also available through Hellion Records.de) and also in the years before that, Shadowlord(playing and recording regularly throughout the middle nineteen nineties, releasing a full album self titled cd in 2000). Dereck did: The Devil Inside, and they released a very bluesy cd album. Witchcross always reunited and performed more concerts, as well as writing a myriad of new original material, and performing as a Black Sabbath tribute band at many other shows.

By 2008, Witchcross decided to record another album that would be entitled “Innocence And Evil”, and released it professionally on cd, self-financed, and distributed through underground distros and local record stores. Many more live concert performances continued on a regular basis, though also once again the band began focusing more on other band projects and kinda slowed down, Count William once again drifted further into Ravensthorn, with the band playing out a lot more and becoming immersed in the band’s “Horrors Of The Black Mass” album project and promotional live concert shows that went on for a few years at several studios before being released in 2012, though during this time Witchcross was still playing out live on a regular basis between Ravensthorn(heavy metal band) shows…

When Witchcross began the recording for 2014’s “Crypt Of the Undead” album at Chicago’s The Dead Room Studios with engineer producers Joe Duhr and Chad Elliott,and final mastering done by Sasch Machyne (of Mighty Monster Records-Germany). They wanted to properly capture the band’s live sound, and they finally did. For once the band was 100% focused and also captured in a recording properly, and wickedly in the right way..

Currently, in 2015, Witchcross is releasing a very heavy and Occult based third album of wickedly produced Horror Doom Metal Musick, working together stronger than ever, a 13 song album, called “Crypt Of The Undead” on Germany’s Metalizer/Battle Cry Records, and also performing many new concert shows all over the place. Another very heavy new Witchcross record will be in the works at the end of 2015 too!!!

COVEN BIO

It wouldn’t be a stretch to consider COVEN to be the progenitor of what we now know as occult rock; years before every other heavy band proclaimed to be performing rituals on stage and draping themselves in powerful symbolism – Jinx and co were living it. The furore that surrounded the 1969 release of Witchcraft Destroys Minds & Reaps Souls persisted for many years afterwards, the band dogged by controversy everywhere they went.

The forward-thinking themes and powerful imagery explored by COVEN paved a pathway for those open-minded enough to follow. Their influence has been far reaching – from those who shy away from acknowledging this right through to those who worship unreservedly at the altar of COVEN. Jinx Dawson is also recognised as being the instigator of using the “sign the horns” with her hands – a call to arms and a symbol that is used frequently in heavy music across the globe.

 

I know that Witchcross should be on the 1993 to 2003 top 1oo  / top 150, albums of the era list…..but this band has the spiritual connection. wave length, head space, to the foundational bands Coven / Black Sabbath / Mercyful Fate / King Diamond…..I will say straight away that my favorite band from this part of planet metal is Sindrome….this is just subjective….!!!! We do have that event at the KICK ASS METAL offices were we listen to  the top 30 to top 40 albums of all-time from Friday Night to Sunday Morning, then we dig in to our Symphonic Metal and Classical Music Library , and yea so I am going with the Witchcross album “Crypt of the Dead” to go on that TOP 30 albums list that we do every weekend…!!!

I will have to dig through all the copies of the heavy metal fanzines from the era’s that influenced this webzine, this is the kind of metal that we love the most, just heavy metal flavored heavy metal, this is a gothic metal-age/ avant-garde-age/death metal-age publication. So the gothics that read this page….this band is fucking essential to every serious heavy metal collection….!!!!! The heavy metal hall of fame part of this publication is just the top upper-echelon of the top-tier of the gold standard of World-Class Heavy Metal, a proper heavy metal book can only hold 500 to 700 bands…so there is that !! ….!!!! The office I work from has 33,000 square feet, makes a good library for a serious music collection and nothing else, I image the heavy metal hall of fame that the likes of Gary Scahffer talks about to be a college university sized place….i realized i wanted mine if i raise the money for that to be like a haunted house, and just each room just to be its own genre, and the farther you walk down the hall the farther you get in to the present, but for sure it has to be like a haunted house !!!! ….ha ha !!!!!! I have to sift through these pages to find you the top 100’s in each style, the news part of this places adds thousands of band each decade, because news is just news, so you know when to get to the record store…..!!! So for the top 100s Witchcross will be on various top 100’s list in this publication. But just letting you know to get the back catalogue and my subjective/objective favorite is Witchcross “Crypt of the Dead”…..!!!!! I was offered the book offer 2 weeks ago, and my offer was $2 million dollars, why fuck around…so ha ha that dude left my office, like he seen a ghost or something….get the fuck out..don’t let the door hit you on your ha ha…..i really do not want to run a book/hall of fame on under-budget….!!!!  I wanted to say everything killer metal, and kick ass will be interconnected here…!!! Sometimes I will make sure, that bands are on certain top 100’s, because so you can print out the article, and have fun collecting, everything again as a old metal fan, or as someone new to heavy metal, just the essentials, with 3 or 4 months of perfect perfection hitting the stores, when music is timeless, it should not matter what top 100 list they are one, but i want the readers to have a razorsharp focus on this band. And you know what to do !!!

 

 

 

 

Abattoir- Vicious Attack

Accept- Restless and Wild

Acid- Acid

ACID * MANIAC

Agent Steel- Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis- Screams and Whispers

ANGEL DUST- INTO THE DARK PAST

Angel Witch * Angel Witch

ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland

ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS

Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECRODS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…

Anvil- Metal on Metal

ANVIL- FORGED IN FIRE

Anvil- Live in concert

Anvil-Worth the weight

ANVIL CHORUS * THOUGHT CRIMES

Anvil Chorus * The Killing Sun

Artillery * Fear Of Tomorrow

ARTILLERY * TERROR SQUAD

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

ATTACKER * BATTLE AT HELM’S DEEP

ATTACKER * THE SECOND COMING

ATTACKER * GIANTS OF CANAAN

ATTACKER * SINS OF THE WORLD

BATHROY * BATHORY

Bathory * The Return…

Bitch * Damnation Alley

Bitch- Be My Slave

Black Flag “Damaged”

Black Flag “My War”

Black Flag “Slip It In”

Black Flag “Live ’84”

Black Flag “Loose Nut”

Black Flag “In My Head”

Black Flag “Who’s Got the 10/2”

Black Sabbath- Mob Rules

BLIND ILLUSION- THE SANE ASYLUM

BLOODLUST “GUILTY AS SIN”

BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS

BLITZKRIEG * A TIME OF CHANGES

CACOPHONY- SPEED METAL SYMPHONY

Candlemass-Nightfall

Cage- Astonomy

Cathedral- Supernatural Birth Machine

CELTIC FROST- MORBID TALES

Celtic Frost- Emperors Return

Celtic Frost- To Mega therion

CELTIC FROST- INTO THE PANDEMONIUM

Chastain * Mystery of Illusion

Chastain * Ruler of the Wasteland

Chastain * The 7th of Never

Chastain * The Voice of Cult

Chastain- For those who Dare

CHASTAIN- IN A OUTRAGE

COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE

Coven * Jinx

COVEN13 * Worship New Gods

CIRITH UNGOL * FROST AND FIRE

CIRITH UNGOL * KING OF THE DEAD

Crimson Glory- Crimson Glory

CRYPTIC SLAUGHTER * CONVICTED

Culprit- Guilty As Charged

 

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld

 

DARK ANGEL * DARKNESS DESCENDS

DARK ANGEL * LEAVE SCARS

DEF DEALER * KEEPER OF THE FLAME

DEF DEALER * JOURNEY INTO FEAR

DEATH- SCREAM BLOODY GORE

DEATH * LEPORSY

DEATH- SPIRITUAL HEALING

DEATH- HUMAN

DEATH-INDIVIDUAL THOUGH PATTERNS

DEATH * Symbolic

Death Angel- The Ultra-Violence

Death Angel “Frolic Throgh the Park

DEATH ANGEL- ACT III

Death Strike-Fuckin’ Death

Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe

Ded Engine * Hot Shot

Ded Engine * Hold A Grudge

Deep Switch- Nine inches of God

DESTRUCTION- INFERNAL OVERKILL

 

DESTRUCTOR “MAXIMUM DESTRUCTION”

 

Détente “Depths of Death”

Diamond Head * Diamond Head…1980 …aka Lightning to the Nations

Diamond Head- Lightning to the Nations

Diamond Head- Behold the Beginning

Discharge * Hear Nothing, See Nothing, Say Nothing

Dream Death- Journey Into Mystery

DOCTOR BUTCHER- DOCTOR BUTCHER

EXCITER- HEAVY METAL MANIAC

Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS

EXCITER  HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

Exhorder- Slaughter in the Vatican

EXODUS- A LESSON IN VIOLENCE-  October 31st, 1984 1984 ADVANCE CASSETTE

EXODUS- BONDED BY BLOOD

EXODUS- PLEASURES OF THE FLESH

EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)

EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)

Exorcist * Nightmare Theatre

EXUMER * POSSESSED BY FIR

FATES WARNING * NIGHT ON BROKEN

Fear of God * Within The Veil

FORBIDDEN- FORBIDDEN EVIL

FORBIDDEDN * TWISTED INTO FORM

 

THE GATHERING * MANDYLION

THE GATHERING * NIGHTTIME BIRDS

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS

GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS

THE GREAT KAT- WORSHIP ME OR DIE!

THE GREAT KAT- BEETHOVEN ON SPEED

 

Griffin- Flight of the Griffin

Hawaii- One Nation Underground

HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK

HALLOWEEN- DON’T METAL WITH EVIL

HALLOWEEN “NO ONE GETS OUT!”

HALLOWEEN “NO ONE GETS OUT!” MOLTEN METAL RECORDS PRESSSING/ with the Vicious Demo”

Hell- Hell (1982/1986 compilation )…Demos come with 2 disc version of 2011 debut CD

H-Bomb- Attaque

HEATHEN- BREAKING THE SILENCE

HEATHEN- VICTIMS OF DECEPTION

HEATHEN-RECOVERED

HIRAX- RAGING VIOLENCE

HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD

HOLOCAUST- THE NIGHTCOMERS

Ice Age “Break the Ice”

 

 

 

Insanity- Death after Death

IRON MAIDEN- IRON MAIDEN

IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games

JAG PANZER- AMPLE DESTRUCTION

Judas Priest * Killing Machine

Judas Priest * Hellbent for Leather * aka Killing Machine

JUDAS PREIST * UNLEASHED IN THE EAST

Judas Priest- British Steel

Judas Priest- Painkiller

King Diamond-Fatal Portrait

King Diamond- Abigail

King Diamond- Them

Kreator- Endless Pain

Kreator – Pleasure to Kill

Liege Lord- Master Control

Macbre- Gloom

Malediction- Condamnes

Manowar * Battle Hymns

MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS

MANOWAR * HAIL TO ENGLAND

Manowar * Sign of the Hammer

Manowar “Fighting The World”

 

Manowar “Kings of Metal”

Massacre- From Beyond

 

MASSACRE “BACK FROM THE DEAD”

 

MASTER- MASTER

MASTER- 1985 ALBUM UNRELEASED

 

MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album

Medieval- ALL KNOBS TO THE RIGHT

MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP

MEDIEVAL- MEDIEVAL KILLS

MEDIEIVAL “DEMOS” 2010 CD AMTEX/ MEDIEVAL — SELF REALIZED

MEGADETH- RUST IN PEACE

 

MENTORS “YOU AXED FOR IT”

MERCYFUL FATE-  “Mercyful Fate” November 25th, 1982 EP

MERCYFUL FATE- MELISSA

MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS

MERCYFUL FATE- THE BEGINNING

MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS

METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP

METALLICA- NO LIFE TIL LEATHER

METALLICA- NO LIFE TIL LEATHER version w/ 16 minute Ron McGovney interview

METALLICA- NIGHT OF THE RIVETTHEADS …aka No life til leather wit Power metal bonus tracks tacked on the end, but during remastering the sound was speed-up for the effect of extra heaviness/ savage factor.

METALLICA- KILL EM ALL * MEGAFORCE RECORDS

Metallica- RIDE THE LIGHTNING * MEGAFORCE RECORDS

Metallica- Creeping Death/ Jump in the Fire CD

Metallica- Master of Puppets

Morbid Angel- ABOMINATIONS OF DESOLATION

MORBID ANGEL- ALTARS OF MADNESS

MORBID ANGEL BLESSED ARE THE SICK

MORBID ANGEL * COVENANT

MORDBID ANGEL * DOMINATION

MORBID ANGEL* ENTANGLED IN CHAOS

 

Mötley Crüe “Too Fast for Love” December 15th, 1981 Leathür Records Pressing

 

Mötley Crüe “Shout At the Devil”

Motörhead – Ace of Spades

MOTORHEAD- NO SLEEP TIL HAMMERSMITH

Motorhead * Iron Fist

Motörhead  * Another Perfect Day

Motörhead * No Remorse

Motörhead * Orgasmatron

Nasty Savage- Nasty Savage

NASTY SAVAGE- INDULGENCE

 

NERVOSA were originally THE 4 HORESMAN OF THE APOCALYPSE….ala, Metallica 1982/1986 …..

Prika Amaral * Fernanda Lira * Fernanda Terra * Karen Ramos

NERVOSA * 2012

 

 

nervosa2012top100heavymetalhalloffamealbumsofalltimemetalgodslegends9768967875463

NERVOSA * TIME OF DEATH

nervosaterraamaralliraeraheavymetalhalloffamemarch2012a999877771

NERVOSA * VICTIM OF YOURSELF

nervosavictimofyourselftop100heavymetalalbumofalltime5a9879876661

nervosavictimofyourselfkickassmetalheavymetallegends8797896785667465344

NERVOSA * AGONY

nervosa2016heavymetalalbumoftheyearheavymetalgods97897896856743

nervosaheavymetalgodslegends98797896772341413431242323423

amaral-lira-landa-eranervosametalgodsheaaymetallegends89879678564533424

amaral-dametto-lira-eranervsoaheavymetallegnds98796786757543523424233523423423

moniquelantnervosafannumber1nervsoametalgodslegendsa9768776632a9986785742

NME * UNHOLY DEATH

Nuclear Assault “Game Over”

 

 

OBITUARY * SLOWLY WE ROT

OBITUARY * Cause of Death

Obilevon * From this Day Forward

Obliveon * Nemesis

ONSLAUGHT- THE FORCE

Onslaught * Power From Hell * 1987 Combat Records Version

Original Sin * Sin Will Find You Out

OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS

OZ- Fire in the Brain

OZ – III Warning

Ozzy Osbourne- Blizzard of Ozz

Ozzy Osbourne-Diary of a Madman

 

Ozzy Osbourne “Tribute”

 

Pagan Altar * 1982 Demo Cassette

Pagan Altar- Pagan Altar Volume 1

PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1

PILE DRIVER- METAL INQUISITION

PILE DRIVER * STAY UGLY

Pentagram- Pentagram

Pentagram- Day of Reckoning

Pentagram * Relentless 1985 debut Retitled

Pentagram- Be forewarned

POSSESSED- SEVEN CHURCHES

Raven * Rock Until You Drop

RAVEN * Wiped Out

RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS

RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS

RAZOR- EXECUTIONERS SONG

RAZOR- EVIL INVADERS

REPULSION * SLAUGHTER OF THE INNOCENT

REPULSION – HORRIFIED

Riot- Fire Down Under

Riot- Thunder Steel

Riot- Privilege of Power

 

The Rods “Wild Dog”

RUSH * A FARWELL TO KINGS

RUSH * PEMANENT WAVES

RUSH- MOVING PICTURES

RUSH * EXIT…STAGE LEFT

RUSH- SIGNALS

RUSH- GRACE UNDER PRESSURE

RUSH- POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * PRESTO

RUSH * CHRONICLES

RUSH * TEST FOR ECHO

RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME

SABBAT ( NIPPON) * ENVENOM

SABBAT ( NIPPON) * EVOKE

SABBAT ( NIPPON) * DISEMBODY

SATAN * INTO THE FIRE * November 17th, 1982 CASSETTE DEMO

SATAN- COURT IN THE ACT

SAVATAGE * Sirens

SAVATAGE * The Dungeons are Calling

Scorpions- Taken By Force

SACRIFICE- Torment in Fire

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLIDERS OF MISFORTUNE

SACRIFICE * APOCALYPSE INSIDE

 

SEPULTURA “Morbid Visions”

 

Sepultura “Schizophernia”

SEPULTURA- BENEATH THE REMAINS

Skullview- Kings of the Universe

Sindrome- Sindrome (2 demos on CD) * May 12th, 1999 BRUTAL RECORDS PRESSING

 

SINDROME “RESURRECTION……”

SLAUGHTER- STRAPPADO

SLAUTER XSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER- SHOW NO MERCY

SLAYER- HAUNTING THE CHAPEL

SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS

SLAYER “REIGN IN BLOOD”

 

SLAYER “SOUTH OF HEAVEN”

 

SLAYER “SEASONS OF THE ABYSS”

 

SLAYER “DECADE OF AGRESSION”

 

SODOM * IN THE SIGN OF EVIL

SODOM * OBSESSED BY CRUELTY

STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades

Tank- Power of the Hunter

TANK- THIS MEANS WAR

TERRORIZER-WORLD DOWNFALL

Testament- The Legacy

THRUST * Fist Held High

TROUBLE * LIVE * May 2nd, 1983 CASSETTE ON METAL ENTERPRISES

TROUBLE- PSALMS 9

TROUBLE * THE SKULL

TYGERS OF PAN TANG- WILD CAT

Tygers of Pan Tang- Spell Bound

TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent

Unseen Terror- Human Error

Venom- Welcome to Hell

Venom- Black Metal

Venom * At War with Satan

VICIOUS RUMORS * Soldiers of the Night

VICIOUS RUMORS * Digital Dictator

VIO-LENCE * ETERNAL NIGHTMARE

Voi Vod- War and Pain

Voi Vod- RRRROOOOAAAARRR

 

Wargasm- Why Play Around ?

Warfare * Pure Filth

WARFARE-METAL ANARCHY

Warfare * Mayhem Fucking Mayhem

Warlock * Burning The Witches

Warlock * Hellbound

Warlock * True As Steel

WARLOCK “TRIUMPH AND AGONY”

Warlord-Deliver Us

Warlord * And The Cannons Of Desturuction Have Begun

Warlord * Thy Kingdom Come * 1st EP and LP on CD

Warhead * Speedy Way

WARHEAD- THE DAY AFTER

Warning- Aftermath …contains the August 23rd, 1985 “NOT A CHANCE IN HELL DEMO”

WATCHTOWER- ENERGETIC DISASSEMBLY

 

WASP “WASP” * August 17th, 1984

Wildestarr * Arrival

WITCHCROSS- FIT FOR FIGHT

Witchcross “Witchcross”

Witchcross “Innocence and Evil”

WITCHCROSS “CRYPT OF THE DEAD”

WITCHFINDER GENERAL- DEATH PENALTY

WITCHFINDER GENERAL- FRIENDS OF HELL

Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

 

THIS IS THE SECOND WITCHCROSS TOP 100/TOP 15O ALBUMS OF ALL-TIME LIST THIS IS THE BEST OCCULT ROCK/OCCULT METAL, HORROR METAL AND DARK METAL ALBUMS OF ALL-TIME

http://www.occultrock.com

 

 

 

 

 

Video Above Ravyn Bedard featured here because it KICK’S ASS !!!!!!!!!!!

https://www.facebook.com/killerdwarf7/

 

Growing up in the late 1970’s and early 1980’s there was a primer book for what is now called Occult Rock,

http://www.occultrock.com/ the definition, for the occult rock webzine is “oc*cult beyond the range of ordinary

knowledge or understanding , ie mysterious, this book was called Encyclopedia Metallica with 2 versions one in 1981 and

one in the summer of 1983, as “a heavy metal bible” as the book was advertised it failed miserably, but for fans of Hair

Metal, Avant-Garde Metal, Alternative Metal, Occult Rock, Dark Metal, Horror Metal, and all things loud and proud, those

books are fucking essential, to say the least, it will help you easily navigate the pages of Occult Rock WebZine….I am

a huge fan of that webZine, alongside tons of others, I wanted to do this article like this, to start leaving the information

on the best of the best of this style….!!!! There has been a prediction that there will be less and less of news coverage for

this style of music, but with albums coming from Lucifer, Deathless Legacy, and Witchcross, there is now way, this Kick

ASS music and KICK ASS METAL will be on the back-burner, those artist/ albums will be front and center for all of

2018 and the rest of my tenure here until my successor takes over around 2045……!!!!!!!!!!!!!!!! The TOP 100 albums list

below in not finished, but wanted to get the ball-rolling on this no matter what !!!!

 

 

Avatarium “Avatarium”

Avatarium “The Girl With The Raven Mask”

Avatarium “Hurricanes & Halos”

Bathsheba “Servus”

Black Sabbath “Black Sabbath”

Black Sabbath “Paranoid”

Black Sabbath “Master of Reality”

Black Sabbath “Volume 4”

Black Sabbath “Sabbath Bloody Sabbath”

Black Sabbath “Sabatoge”

Blood Ceremony “Blood Ceremony”

Blood Ceremony “Living With The Ancients”

Blood Ceremony “The Eldritch Dark”

Blood Ceremony “Lord of Misrule”

Coven “Witchcraft “Witchcraft Destroys Minds and Reaps Souls”

Coven “Coven”

Coven “Blood On The Snow”

Coven “Metal Goth Queen Out of the Vault”

Coven “Jinx”

Deathless Legacy “Dance With The Devils”

Deathless Legacy “Rituals of Black Mass”

Death Penalty “Death Penalty’

The Devil’s Blood “Th Thousandfold Epicenter”

Electric Wizard “Black Masses”

Electric Wizard “Time To Die”

Electric Wizard “Wizard Bloody Wizard”

Ghost “Opus Eponymous”

Ghost “Infestissumam”

Ghosts “Meliora’

Huntress “Spell Eater”

Huntress “Starbound Beast”

Huntress “Static”

Jess and the Ancient Ones “Jess and the Ancient Ones”

Jess and the Ancient Ones “Second Psychedelic…The Aqaruius Tapes

Jess and the Ancient Ones “The Horse and Other Weird Tales’

Jex Thoth “Jex Thoth”

Jex Thoth “Blood Moon Rising”

Kabbalah “Spectral Ascent”

King Diamond “Fatal Portrait”

King Diamond “Abigail’

King Diamond ”  “Them”  ”

Lucifer “Lucifer I”

Lucifer “Lucifer II”

Mercyful Fate “Melissa”

Mercyful Fate “Don’t Break The Oath”

Mercyful Fate “Curse of the Pharaohs ”

Mercyful Fate “Return of The Vampire”

Mercyful Fate “In The Shadows”

Mount Salem “Endless’

The Oath “The Oath”

Orchid “Capicorn”

Orchid “The Mouths of Madness”

Psychedlic Witchcraft “Sound of the Wind”

Purson “The Circle And The Blue Door”

Purson “Desire’s Magic Theatre”

Riti Occulti “Riti Occulti”

Riti Occulti “Secta”

Sabbat “History of A Time To Come”

Sabbath Assembly “Rites of Passage”

Sabbath Assembly “Sabbath Assembly”

The Skull “For Those Which Are Asleep”

Uncle Acid & The Deadbeats “Bloodlust”

Witchcross “Witchcross”

Witchcross “Innocence & Evil”

Witchcross “Crypt of the Dead”

Witchcross “Cauldron in Satan’s Shadow”

Witch Mountain “South of Salem”

Wooden Stake “Dungeon Prayers & Tombyard Serenades”

Wooden Stake “A Feast of Virgin Souls”

Vaultwraith “Death is Proof of Satans Power”

 

 

 

 

 

 

Leaves Eyes

Sign of the Dragonhead

January 12th, 2018

AFM RECORDS

AFM – 611

KICK ASS METAL RATING

100 OUT OF 100 BLOOD DRIPPING FUCKING SKULLS

FULL SCORE

PERFECT SYMPHONIC HEAVY METAL

FUCKING ESSENTIAL

KICK ASS METAL HEAVY METAL HALL OF FAME ALBUM

2018 KICK ASS METAL SYMPHONIC METAL ALBUM OF THE YEAR

 

Whoa this album rules, it for sure will get tons of spins in between metal classics such as Iron Maiden “Killers”, Satan “Court in the Act” and Mercyful Fate “Melissa” I have my favorites and you have yours. And this fits in heavy rotation between top-notch world-class heavy metal metal klassiker timeless masterpieces such as those for the same reason. World-Class Vocals, Killer Rhythm Section, Bone Crunching Molten Metal Guitars. The Guitar team of Thorston Bauer/ Pete Streit is untouchable, MASTERS OF METAL, second to none, As a heavy metal fan since 1978, well all have the same subjective favorites, as well as the same objective favorites, but I really am a big fan of Elina Siirala, a top-notch World-Class Vocalist no fucking doubt about that….Oh I have checked the actual heavy metal news services for the genre, and styles I cover

http://www.metalmaidens.com

&

http://www.soniccathderal.com

 

Whoa….no news on this album yet…ha ha, so arrrrggghhhh man, KICK ASS METAL is up first..for the heavy metal media that appreciates traditional World-Class Vocalist, and World-Class Musicianship…and like always, when something this KICK ASS METAL happens, we have to scream it from the mountain top…. We cover the top 700 bands from each subgenre of gothic/ metal/ avant-garde, want a specialized press for whatever this or that subgenre go read those…I DO…!!!

When a band has a perfect 15/ 25/ 30 year career, ala Leaves’ Eyes and the likes, why should the be ignored, especially when there ranking has been the same since the debut album !!!!!!!!!!!!! 2003–to—2018…15 years of one of the greatest heavy metal bands of all-time. If you want to check your emotions and your objective-side, just good fucking luck opening a actual HEAVY METAL HISTORY book and not seeing a Atrocity, Theatre of Tragedy, Leaves’ Eye section on this HUGE part of metallic history, if a section like that is ever missing, just leave it be, because everyone knows even those new to heavy metal that part of the history book WILL ALWAYS BE THERE, as IMMORTALS OF METAL.

Actually since the last full length, Leaves’ Eyes are a top favorite and here, 1 band, move-up in rankings to the top because of a mind-blowing debut release, but Leaves’ Eyes are still at the top of the upper-echelon of World-Class Symphonic Heavy Metal, because they are heavy, and know there metallic music theory inside out, and have the best RIFFS and best song-writing, as well as song-writing skills, and the BEST SOUNDING METALLIC ALBUMS, ala Mastersound Entertainment !!!!!!!!! ….Truth be told, Leaves’ Eyes are always a top most anticipated album when they release a album, alongside Nervosa, and Edge of Paradise.

Where Leaves’ Eyes will always leave a indelible mark on your psyche, is in a live setting, where they rule, just metal to the bone all the way, and nothing else. Leaves’ Eyes concerts are some of the best of all-time in heavy metal metallic history… nothing put postive vibes, with one of the coolest fanbases in all of heavy metal. Each band member has total stage presence, confidence and charisma

Symphonic Saviors albums of the year in Symphonic Metal from November 1st, 1997 —  t0  — to January 12th. 2018

Since this is a Publication dedicated to World-Class Heavy Metal, featuring World-Class Vocalist, this is the criteria objectively / subjectively we know the aspect of music theory that gives the most evocation, IE the most Mind-blowing, jaw dropping chills up and down the spine.

THE SYMPHONIC HEAVY METAL ALBUMS OF THE YEARS FROM 1997 TO 2018….Oh a l@@k who is a 5 time winner on this list Leaves’ Eyes !!!!!!!!!!!!

2018 Leaves’ Eyes “Sign of the Dragonhead”

2017  The Dark Element “The Dark Element

2016 Epica “The Holographic Principle”

2015 Leaves’Eyes “King of Kings”

2014 Savn “Savn”

2013 Leaves’ Eyes “Symphonies of the Night”

2012 Delain “We Are The Others”

2011 Nightwish “Imaginaerum”

2010 ReVamp “ReVamp”

2009 Leaves’Eyes “Njord”

2008 Mindattsol “Nordyls”

2007 Nightwish “Dark Passion Play”

2006 Angtoria “God Has a Plan For Us All”

2005 Leaves’Eyes “Vindland Saga”

2004 Nightwish “Once”

2003 Evanescence “Fallen”

2002 Nightwish “Century Child”

2001 Lacuna Coil “Unleashed Memories”

2000 Nightwish “Wishmaster”

1999 Lacuna Coil “In A Reverie”

1998 Nightwish “Oceanborn”

1997 Nightwish “Angels First Fall”

Some are going to claim Evanescence,  and Lacuna Coil are more Gothic  Metal than Symphonic Metal.  Symphonic Metal has its roots in Celtic Frost for it’s first era, and the 3rd and The Mortal for it’s current era, and of course. Celtic Frost and 3rd and The Mortal, are progenitors of more than 1 genre. Lacuna Coil stated the never heard of the Gathering even if they were in the same Fanzines, and Century Media “Identy” Various Artists Complilations. And Lacuna Coil stated more than once they are just straight-up “Metal”but list influences from all-over the metal spectrum, and bands like Dreams of Sanity were killer in 1998, 1999 and 2000, but thought they had to much avant-garde /gothic in there asthetics.

 

Biography

LEAVES’ EYES – Music History

For more than a decade now, LEAVES’ EYES have been setting world history to music and undeniably, by doing so, have raced to the top of the symphonic metal tree.

With their new monumental epic “King Of Kings”, the band now further justifies their leading position as a compass in the genre and re-awakes the thousand-year legend of Norway’s first king, ‘Harald Fairhair’, in the process. Again this band prove their amazing talent of capturing sagas and legends of the past and truly making them come alive in the here and now. Welcome the Vikings!

LEAVES’ EYES has always been a band of superlatives: the international group has toured on five continents, playing concerts in more than 50 countries. Their live shows are spectacular events with breathtaking stage scenery, including a Viking ship or even the “Swords In Rock” monument from singer Liv Kristine’s home town. On their studio albums, the band has constantly followed the steps of classical composers from the past. Debut “Lovelorn” (2004) lead them first for subject matter, to Norway, home country of former vocalist Liv and full of myths and legends. The concept effort made the musicians’ wonderment at Scandinavia’s vast nature graspable and later this found its continuation with 2005’s “Vinland Saga”, whose story told of the Viking’s exploration of America and its result. The success was immediate, as the album (and its hit single “Elegy”) remained in the charts for four weeks. What’s more, from that point on all LEAVES’ EYES releases would follow that same tradition and achieve high chart positions, whether it was the orchestral metal opus “Njord” (2009), impressively remembering the Vikings’ exploration of all parts of the world, or the complex “Meredead” (2011), which delved into tales of Scandinavian legends, connected to life, death and the power of the ocean. LEAVES’ EYES effortlessly combine traditional folk, mystic sounds of the past and a symphonic orchestra with brutal, metal rawness, and this was no truer than when, for their 10th anniversary, the band released the highly-acclaimed “Symphonies of the Night”, an album which features all their traditional trademarks, turned into a sweeping metal opera.

Now LEAVES’ EYES lead us back in time to when Harald I was uniting Norway as one kingdom. With an almost cinematic intensity, the band has you see the battle of Hafrsfjord itself. “King of Kings” sounds as if film score composers Hans Zimmer and Richard Wagner themselves had collaborated on a soundtrack about the life of Norway’s first king with amazing results. The epic title track with its huge choirs (brought to you by the “London Voices” ensemble, who have famously worked on movie productions such as “Star Wars”, “Lord of the Rings” and “Harry Potter” amongst many) gives a perfect start to the saga. It’s a perfect match to the band’s ambitions and to the vision of producer Alexander Krull, who sonically lifts “King of Kings” to the level of these blockbuster productions. Whilst, under the guidance of ex – Rage guitarist Victor Smolski, the powerful White Russian Symphony Orchestra adds even more feel. Despite all this musical variety and epicness though, LEAVES’ EYES never lose their grasp for hits! Songs such as “The Waking Eye” and the massive “Halvdan the Black” (which is about Harald’s fateful father) will definitely become gothic/metal club hits…. And, the rousing hymn “Edge of Steel” sees two of the genre’s biggest stars join forces: Liv Kristine and guest singer Simone Simons (Epica) together leading us right onto the battlefields of Harald I himself……

“King of Kings” offers stylistic diversity everywhere you look; from folk rock and gentle tunes to symphonic, epic, heavy hymns; it’s an impressive display of the artists’ involved multifaceted qualities.

We could tell you more; a further highlight is the gigantic “Blazing Waters” (featuring Lindy- Fay Hella – Wardruna), which comes across as a musical vision of the decisive battle as real as anything you’ll hear on a record, whilst natural Celtic /ethnic elements and also percussion add an authentic feel to rockers such as “Vengeance Venom” and “Swords in Rock”, which will endear them equally to pagan and Viking metal fans alike.

“King of Kings” is without doubt truly music in wide-screen format, the band creating musical pictures which really make the whole era come alive.

Robert Suß

Line-up:

Elina Siirala – Vocals



Alexander Krull – Vocals


Thorsten Bauer – Guitar, Bass

Pete Streit – Guitar
—-photo credit Ton Dekker (C)(P)(TM)—


Joris Nijenhuis – Drums

 

 

 

 

 

 

LEAVES’ EYES SELECT DISCOGRAPHY

 

Lovelorn

August 17th, 2004

TOP 100 HEAVY METAL ALBUMS OF 2004

 

Viland Saga

May 30th, 2005

TOP 100 HEAVY METAL ALBUMS OF 2005

SYMPHONIC HEAVY METAL ALBUM OF THE YEAR

TOP 20 SYMPHONIC HEAVY METAL  ALBUMS OF ALL-TIME

 

We Came with the Northern Winds/ En Saga i Belgia

February 27th, 2009

TOP 100 HEAVY METAL ALBUMS OF 2009

 

Njord

August 26th, 2009

TOP 100 HEAVY METAL ALBUMS OF 2009

SYMPHONIC HEAVY METAL ALBUM OF THE YEAR

TOP 20 SYMPHONIC HEAVY METAL ALBUMS OF ALL-TIME

 

Meredead

April 22nd, 2011

TOP 100 HEAVY METAL ALBUMS OF 2011

 

Symphonies of the Night

November 15th, 2013

TOP 100 HEAVY METAL ALBUMS OF 2013

SYMPHONIC HEAVY METAL ALBUM OF THE YEAR

 

Kings of Kings

September 11th, 2015

TOP 100 HEAVY METAL ALBUMS OF 2015

SYMPHONIC HEAVY METAL ALBUM OF THE YEAR

 

Sign of the Dragonhead

January 12th,  2018

TOP 100 HEAVY METAL ALBUM OF 2018

SYMPHONIC HEAVY METAL ALBUM OF THE YEAR

TOP 20 SYMPHONIC HEAVY METAL ALBUMS OF ALL-TIME

 

 

 

 

 

Leaves’ Eyes KILLER CONTACTS 

https://www.facebook.com/leaveseyesofficial

 

http://www.leaveseyes.de/

 

 

https://www.youtube.com/user/LeavesEyesOfficial?user=LeavesEyesOfficial&gl=DE

 

 

 

 

 

 

 

 

 

Video Above Ravyn Bedard featured here because it KICK’S ASS !!!!!!!!!!!

https://www.facebook.com/killerdwarf7/

 

Growing up in the late 1970’s and early 1980’s there was a primer book for what is now called Occult Rock,

http://www.occultrock.com/ the definition, for the occult rock webzine is “oc*cult beyond the range of ordinary

knowledge or understanding , ie mysterious, this book was called Encyclopedia Metallica with 2 versions one in 1981 and

one in the summer of 1983, as “a heavy metal bible” as the book was advertised it failed miserably, but for fans of Hair

Metal, Avant-Garde Metal, Alternative Metal, Occult Rock, Dark Metal, Horror Metal, and all things loud and proud, those

books are fucking essential, to say the least, it will help you easily navigate the pages of Occult Rock WebZine….I am

a huge fan of that webZine, alongside tons of others, I wanted to do this article like this, to start leaving the information

on the best of the best of this style….!!!! There has been a prediction that there will be less and less of news coverage for

this style of music, but with albums coming from Lucifer, Deathless Legacy, and Witchcross, there is now way, this Kick

ASS music and KICK ASS METAL will be on the back-burner, those artist/ albums will be front and center for all of

2018 and the rest of my tenure here until my successor takes over around 2045……!!!!!!!!!!!!!!!! The TOP 100 albums list

below in not finished, but wanted to get the ball-rolling on this no matter what !!!!

 

 

Avatarium “Avatarium”

Avatarium “The Girl With The Raven Mask”

Avatarium “Hurricanes & Halos”

Bathsheba “Servus”

Black Sabbath “Black Sabbath”

Black Sabbath “Paranoid”

Black Sabbath “Master of Reality”

Black Sabbath “Volume 4”

Black Sabbath “Sabbath Bloody Sabbath”

Black Sabbath “Sabatoge”

Blood Ceremony “Blood Ceremony”

Blood Ceremony “Living With The Ancients”

Blood Ceremony “The Eldritch Dark”

Blood Ceremony “Lord of Misrule”

Coven “Witchcraft “Witchcraft Destroys Minds and Reaps Souls”

Coven “Coven”

Coven “Blood On The Snow”

Coven “Metal Goth Queen Out of the Vault”

Coven “Jinx”

Deathless Legacy “Dance With The Devils”

Deathless Legacy “Rituals of Black Mass”

Death Penalty “Death Penalty’

The Devil’s Blood “Th Thousandfold Epicenter”

Electric Wizard “Black Masses”

Electric Wizard “Time To Die”

Electric Wizard “Wizard Bloody Wizard”

Ghost “Opus Eponymous”

Ghost “Infestissumam”

Ghosts “Meliora’

Huntress “Spell Eater”

Huntress “Starbound Beast”

Huntress “Static”

Jess and the Ancient Ones “Jess and the Ancient Ones”

Jess and the Ancient Ones “Second Psychedelic…The Aqaruius Tapes

Jess and the Ancient Ones “The Horse and Other Weird Tales’

Jex Thoth “Jex Thoth”

Jex Thoth “Blood Moon Rising”

Kabbalah “Spectral Ascent”

King Diamond “Fatal Portrait”

King Diamond “Abigail’

King Diamond ”  “Them”  ”

Lucifer “Lucifer I”

Lucifer “Lucifer II”

Mercyful Fate “Melissa”

Mercyful Fate “Don’t Break The Oath”

Mercyful Fate “Curse of the Pharaohs ”

Mercyful Fate “Return of The Vampire”

Mercyful Fate “In The Shadows”

Mount Salem “Endless’

The Oath “The Oath”

Orchid “Capicorn”

Orchid “The Mouths of Madness”

Psychedlic Witchcraft “Sound of the Wind”

Purson “The Circle And The Blue Door”

Purson “Desire’s Magic Theatre”

Riti Occulti “Riti Occulti”

Riti Occulti “Secta”

Sabbat “History of A Time To Come”

Sabbath Assembly “Rites of Passage”

Sabbath Assembly “Sabbath Assembly”

The Skull “For Those Which Are Asleep”

Uncle Acid & The Deadbeats “Bloodlust”

Witchcross “Witchcross”

Witchcross “Innocence & Evil”

Witchcross “Crypt of the Dead”

Witchcross “Cauldron in Satan’s Shadow”

Witch Mountain “South of Salem”

Wooden Stake “Dungeon Prayers & Tombyard Serenades”

Wooden Stake “A Feast of Virgin Souls”

Vaultwraith “Death is Proof of Satans Power”

 

 

 

https://www.facebook.com/theheardofficial/

https://www.instagram.com/theheardofficial/

GMR Music Group Website 

https://www.gmrmusic.se/

THE HEARD, the new Swedish hard rock/ heavy metal band featuring former CRUCIFIED BARBARA guitarist Klara “Force” Rönnqvist Fors, bassist Ida “Evileye” Stenbacka and drummer Nikki Wicked (a.k.a. Jannicke Lindström) alongside DEATHSTARS bassist Jonas “Skinny Disco” Kangur (on lead guitar) and burlesque performer, model and singer Pepper Potemkin, has released the official lyric video for its first single, “White Lightning”. The song is available on iTunes, Spotify and other digital platforms.

THE HEARD will make its live debut at the Where’s The Music festival in Norrköping, Sweden on February 10.

THE HEARD’s Facebook page describes the group as being about “heavy riffs, misty songs, dark waters and a death supreme.”

THE HEARD Hails from Stockholm, Sweden is

* Klara Force (CRUCIFIED BARBARA) – Guitar


* Ida Evileye (CRUCIFIED BARBARA) – Bass 

* Nikki Wicked (CRUCIFIED BARBARA) – Drums


* Jonas “Skinny Disco” Kangur (DEATHSTARS) – Lead Guitar


* Pepper Potemkin – Vocals

CRUCIFIED BARBARA announced its breakup in June 2016, two years after the release of the band’s fourth album, “In The Red”. The group explained at the time that “our lives have parted and we need to move on. The last years have taken its toll on all of us and the joy of playing together got lost somewhere along the way.”

 

Ida, Klara and Nicki formed The Heard after the break up of their former band Crucified Barbara. The void left a hunger to create new music and when Klara met long time friend Skinny (Deathstars) at a record fair it was obvious he had the same urge. Another friend, burlesque queen Pepper, proved to have a voice to match her vibrant persona so when Ida bumped into Pepper in the subway she asked her to join the cult. So she did and The Heard was a fact.

” We invite you to a creepy island where the characters we sing about lives, in a world where mystique, fantasy and reality meet. The Heard is all about the joy of playing music but the sound is distorted , doomy and dark. See you on the other side!” /The Heard

 

 

…TOP 100/ T0P 150 HEAVY METAL ALBUMS OF ALL-TIME IN THE TRADITIONAL METAL CATEGORY.  HEAVY METAL BANDS WITH WORLD-CLASS RIFF LORDS & FEATURING WORLD-CLASS VOCALIST… 

Abattoir * Vicious Attack

Accept * Restless and Wild

Acid * Acid

ACID * Manic

ACID * LIVE IN BELGIUM

Agent Steel- Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis- Screams and Whispers.

ANGEL DUST- INTO THE DARK PAST

Angel Witch * Angel Witch

ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland

ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS

Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECORDS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…

Anvil- Metal on Metal

ANVIL- FORGED IN FIRE

Anvil- Live in concert

Anvil-Worth the weight

ANVIL CHORUS * THOUGHT CRIMES

Anvil Chorus * The Killing Sun

Artillery * Fear Of Tomorrow

ARTILLERY * TERROR SQUAD

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

Attacker-Battle at Helms Deep

Attacker-Second Coming

Attacker * Soul Taker

Attacker * The Unknown

Attacker * Giants of Cannan

Attacker * Sins of the World

AVATARIUM * AVATARIUM

AVATARIUM * GIRL WITH THE RAVEN MASK

AVATARIUM * HURRICANES AND HALOS

BATHROY * BATHORY

Bathory * The Return…

Benedectium “Uncreation”

BENEDICTUM “SEASON OF TRAGEDY”

Benediticum “Dominion”

Benedticum “Obey”

Bitch * Damnation Alley

Bitch- Be My Slave

Black Death * Black Death * Auburn Records

Black Sabbath- Mob Rules

BLIND ILLUSION- THE SANE ASYLUM

Bloodlust – Guilty As Sin

BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS

BLITZKRIEG * A TIME OF CHANGES

CACOPHONY- SPEED METAL SYMPHONY

Cage- Astrology

Cauchemar “Tenebrario”

Cauchemar “Chapelle ardente”

Candlemass-Nightfall

Carnivore * Carnivore

Cathedral- Supernatural Birth Machine

CELTIC FROST- MORBID TALES

Celtic Frost- Emperors Return

Celtic Frost- To Mega therion

CELTIC FROST- INTO THE PANDEMONIUM

CHASTAIN * MYSTERY OF ILLUSION

Chastain * Ruler of the Wasteland

Chastain * The 7th of Never

Chastain * The Voice of Cult

Chastain- For those who Dare

CHASTAIN- IN A OUTRAGE

CHASTAIN * WE BLEED METAL

Chastain * We Bleed Metal17

Christian Mistress “Agony & Opium”

Christian Mistress “Possession”

Christian Mistress “To Your Death”

COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE

COVEN * JINX

COVEN * Worship New Gods…Coven …aka Coven13

CIRITH UNGOL * FROST AND FIRE

CIRITH UNGOL * KING OF THE DEAD

Crimson Glory- Crimson Glory

Crystal Viper “Legends”

CRYPTIC SLAUGHTER * CONVICTED

Crucified Barbara “In Distortion We Trust”

Crucified Barbara “”Til Death Do Us Party”

Crucified Barbara “The Midnight Chase”

Crucified Barbara “In The Red” 

Culprit- Guilty As Charged

CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld

Dark Angel * We Have Arrived

DARK ANGEL * DARKNESS DESCENDS

DARK ANGEL * LEAVE SCARS

DEF DEALER * KEEPER OF THE FLAME

DEF DEALER * JOURNEY INTO FEAR

DEATH- SCREAM BLOODY GORE

DEATH * LEPORSY

DEATH- SPIRITUAL HEALING

DEATH- HUMAN

DEATH-INDIVIDUAL THOUGH PATTERNS

DEATH * Symbolic

Death Angel- The Ultra-Violence

DEATH ANGEL- ACT III

DEATH PENALTY “DEATH PENALTY82”

Death Strike-Fuckin’ Death

Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe

Ded Engine * Hot Shot

Ded Engine * Hold A Grudge

Deep Switch- Nine inches of God

Demona * Metal Through Time

Demona * Speak With The Devil

DESTRUCTION- INFERNAL OVERKILL

Détente “Recognize No Authority”

Détente “Decline”

Diamond Head * Diamond Head…1980 …aka Lightning to the Nations

Diamond Head- Lightning to the Nations

Diamond Head- Behold the Beginning

Discharge * Hear Nothing, See Nothing, Say Nothing

Dream Death- Journey Into Mystery

DOCTOR BUTCHER- DOCTOR BUTCHER

Doro * Force Majure

Doro * Doro

Doro “Warrior Soul”

Doro “Fear No Evil”

DORO “25 YEARS….AND STILL GOING STRONG”

DORO “RAISE YOUR FIST”

DORO * STRONG AND PROUD”

EDGE OF PARADISE * MASK

EDGE OF PARADISE * IMMORTAL WALTZ

EDGE OF PARADISE * ALIVE

ELECRIC WIZARD “BLACK MASS”

EXCITER- HEAVY METAL MANIAC

Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS

EXCITCER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

Exhorder- Slaughter in the Vatican

EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE

EXODUS- BONDED BY BLOOD

EXODUS- PLEASURES OF THE FLESH

EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)

EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)

Exorcist * Nightmare Theatre

EXUMER * POSSESSED BY FIRE

EXUMER * RISING FROM THE SEA

FATES WARNING * NIGHT ON BROKEN

Fear of God * Within The Veil

FIRESTRIKE “LION AND TIGER”

FORBIDDEN- FORBIDDEN EVIL

FORBIDDEN * TWISTED INTO FORM

THE GATHERING * MANDYLION

THE GATHERING * NIGHTTIME BIRDS

GIRLSCHOOL “HIT AND RUN….REVISITED”

GIRLSCHOOL “GUILTY AS SIN”

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS

GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS

THE GREAT KAT- WORSHIP ME OR DIE!

THE GREAT KAT- BEETHOVEN ON SPEED

THE GREAT KAT- BEETHOVEN SHREDS

Griffin- Flight of the Griffin

Hawaii- One Nation Underground

HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK

HALLOWEEN- DON’T METAL WITH EVIL

HALLOWEEN – No One Gets Out! 

Halloween – No One Gets Out! Molten Metal Records Version w/ The Vicious Demo

Hell- Hell (1982)…1982-1986 Compilation that come with 2 disc version of 2011 CD

H-Bomb- Attaque

HEATHEN- BREAKING THE SILENCE

HEATHEN- VICTIMS OF DECEPTION

HEATHEN-RECOVERED

Hellion * The Black Book

Hellion * To Hellion and Back

HIRAX- RAGING VIOLENCE

HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD

HOLOCAUST- THE NIGHTCOMERS

Holy Moses * The New Machine of Lichtenstien

Holy Moses * Strength, Will, Power, Passion

Holy Moses * In the Power of Now

Imagika * Imagika

Imagika * Worship

IMAGIKA * And So it Burns

Infernal Majesty * None Shall Defy

Insanity- Death after Death

IRON MAIDEN- IRON MAIDEN

IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games

JAG PANZER- AMPLE DESTRUCTION

Judas Priest * Killing Machine

Judas Priest * Hellbent for Leather * aka Killing Machine

JUDAS PREIST * UNLEASHED IN THE EAST

Judas Priest- British Steel

Judas Priest- Painkiller

Kobra and the Lotus “Kobra and the Lotus”

Kobra and the Lotus “High Priestess”

King Diamond-Fatal Portrait

King Diamond- Abigail

King Diamond- Them

Kreator- Endless Pain

Kreator – Pleasure to Kill

Lady Beast * Lady Beast

Lady Beast * Lady Beast II

Lady Beast *  Metal Immortal

Liege Lord- Master Control

LUCIFER “LUCIFER I

Macbre- Gloom

Malediction- Condamnes

Manowar * Battle Hymns

MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS

MANOWAR * HAIL TO ENGLAND

MASSACRE “FROM BEYOND”

MASSACRE “BACK FROM BEYOND”

MASTER- MASTER

MASTER- 1985 ALBUM UNRELEASED

Mastercastle “Last Desire”

MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album

Medieval- ALL KNOBS TO THE RIGHT

MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP

MEDIEVAL- MEDIEVAL KILLS

MEDIEVAL * CASSETTE ALBUM/ ALL KNOBS TO THE RIGHT — DOUBLE PLAY CLASSIC

THE MENTORS * YOU AXED FOR IT

MERCYFUL FATE- 1982 EP

MERCYFUL FATE- MELISSA

MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS

MERCYFUL FATE- THE BEGINNING

MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS

METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP

METALLICA- KILL EM ALL * MEGAFORCE RECORDS

METALLICA – RIDE THE LIGHTNING * MEGAFORCE RECORDS

Morbid Angel- ABOMINATIONS OF DESOLATION

MORBID ANGEL- ALTARS OF MADNESS

MORBID ANGEL BLESSED ARE THE SICK

MORBID ANGEL * COVENANT

MORDBID ANGEL * DOMINATION

MORBID ANGEL* ENTANGLED IN CHAOS

Motorhead- Ace of Spades

MOTORHEAD- NO SLEEP TIL HAMMERSMITH

Motorhead * Iron Fist

Motorhead * Another Perfect Day

Motorhead * No Remorse

Motorhead * Orgasmatron

Mystery Blue “Hell and Fury”

Nasty Savage- Nasty Savage

NASTY SAVAGE- INDULGENCE

Nervosa “2012”

Nervosa  * TIME OF DEATH

Nervosa  *VICTIM OF YOURSELF

Nervosa “Agony”

THE OATH “THE OATH”

OBITUARY * SLOWLY WE ROT

OBITUARY * Cause of Death

Obilevon * From this Day Forward

Obliveon * Nemesis

ONSLAUGHT- THE FORCE

Original Sin * Sin Will Find You Out

OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS

OZ- Fire in the Brain

OZ – III Warning

Ozzy Osbourne- Blizzard of Ozz

Ozzy Osbourne-Diary of a Madman

Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette

Pagan Altar- Pagan Altar Volume 1

PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1

PILE DRIVER- METAL INQUISITION

PILE DRIVER * STAY UGLY

Pentagram- Pentagram

Pentagram- Day of Reckoning

Pentagram * Relentless 1985 debut Retitled

Pentagram- Be forewarned

POSSESSED- SEVEN CHURCHES

RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS

RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS

RAZOR- EXECUTIONERS SONG

RAZOR- EVIL INVADERS

REPULSION * SLAUGHTER OF THE INNOCENT

REPULSION – HORRIFIED

Resistance * ” Resistance”

Riot- Fire Down Under

Riot- Thunder Steel

Riot- Privilege of Power

RUSH * A FARWELL TO KINGS

RUSH * PEMANENT WAVES

RUSH- MOVING PICTURES

RUSH * EXIT…STAGE LEFT

RUSH- SIGNALS

RUSH- GRACE UNDER PRESSURE

RUSH- POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * PRESTO

RUSH * CHRONICLES

RUSH * TEST FOR ECHO

RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME

SADUS * A VISION OF MISERY

Satan “Into the Fire”

SATAN “COURT IN THE ACT”

Satan “Suspended Sentence”

SATAN * LIVE IN THE ACT

Satan * Live Sentence”

Satan “Trail By Fire….”

Satan “Atom by Atom”

SAVAGE MASTER “Mask of Evil”

SAVATAGE * Sirens

SAVATAGE * The Dungeons are Calling

SACRIFICE- Torment in Fire

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLIDERS OF MISFORTUNE

SACRIFICE * APOCALYPSE INSIDE

SCORPIONS * TAKEN BY FORCE

Sentinel Beast “DEPTHS OF DEATH”

SENTINEL BEAST “UP FROM THE ASHES”

SEPULTURA- BENEATH THE REMAINS

Skullview- Kings of the Universe

Sindrome- Sindrome (2 demos on CD)

SINDROME “RESURECTION….”

Sign of the Jackal *  Mark of the Beast

SLAUGHTER- STRAPPADO

SLAUTER XSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER- SHOW NO MERCY

SLAYER- HAUNTING THE CHAPEL

SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS

Slayer- Reign in Blood

SODOM * IN THE SIGN OF EVIL

SODOM * OBSESSED BY CRUELTY

STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades

Tank- Power of the Hunter

TANK- THIS MEANS WAR

TERRORIZER-WORLD DOWNFALL

Testament- The Legacy

TROUBLE- PSALMS 9

TROUBLE * THE SKULL

TROUBLE * RUN TO THE LIGHT

TYGERS OF PAN TANG- WILD CAT

Tygers of Pan Tang- Spell Bound

Tyranex * Extermination Has Begun

Tyranex * Unable to Tame

TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent

Unseen Terror- Human Error

Vainglory * Vainglory

Venom- Welcome to Hell

Venom- Black Metal

Venom * At War with Satan

VICIOUS RUMORS * Soldiers of the Night

VICIOUS RUMORS * Digital Dictator

VIO-LENCE * ETERNAL NIGHTMARE

Voi Vod- War and Pain

Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?

Warfare * Pure Filth

WARFARE-METAL ANARCHY

Warfare * Mayhem Fucking Mayhem

Warlock * Burning The Witches

Warlock * Hellbound

Warlock * True As Steel

WARLOCK * TRIMPH AND AGONY”

Warlord-Deliver Us

Warlord * And The Cannons Of Destruction Have Begun

Warlord * Thy Kingdom Come * 1st EP and LP on CD

Warhead * Speedy Way

WARHEAD- THE DAY AFTER

Warning- Aftermath

WATCHTOWER- ENERGETIC DISASSEMBLY

Watchtower * Control and Resistance

WITCHCROSS- FIT FOR FIGHT

WITCHFINDER GENERAL- DEATH PENALTY

WITCHFINDER GENERAL- FRIENDS OF HELL

WildeStarr “Arrival”

WildeStarr “A Tell Tale Heart”

WildeStarr “Beyond The Rain”

Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland

 

 

 

 

 

 

https://www.facebook.com/LeatherLeone/

https://www.facebook.com/leatherleoneband/

LEATHER, the solo band of CHASTAIN singer Leather Leone, will release its new album, “II”, on March 21 in Japan via Rubicon Music and on April 13 in the U.S. through Divebomb Records and in Europe through High Roller Records. The vinyl version of the album will be made available on June 29 via High Roller (limited to 500 copies, red or black vinyl).

“II” track listing:

01. Juggernaut
02. The Outsider
03. Lost At Midnite
04. Black Smoke
05. The One
06. Annabelle
07. Hidden In The Dark
08. Sleep Deep
09. Let Me Kneel
10. American Woman
11. Give Me Reason

Joining the vocal powerhouse in the new formation are Vinnie Tex (guitar), Thiago Velasquez(bass) and Braulio Drumond (drums).

CHASTAIN’s latest album, “We Bleed Metal”, was released in November 2015. It was the follow-up to the band’s 2013 reunion CD “Surrender To No One”.

Leone has long been considered one of the originators of the female power metal vocal style, having appeared on the classic CHASTAIN albums “Mystery Of Illusion”, “Ruler Of The Wasteland”, “The 7th Of Never”, “The Voice Of The Cult” and “For Those Who Dare”.

The Leather-fronted version of CHASTAIN recorded five CDs in the mid-to-late 1980s: 1985’s “Mystery Of Illusion”, 1986’s “Ruler Of The Wasteland”, 1987’s “The 7th Of Never”, 1988’s “The Voice Of The Cult” and 1990’s “For Those Who Dare”. After the “For Those Who Dare” tour, David and Leather amicably went their separate ways but kept in touch over the years before reuniting in 2013.

Leather in 2012 released the debut album from her SLEDGE LEATHER project, “Imagine Me Alive”. The CD was inspired in 2010 when Leather called Sandy Sledge to collaborate on the Ronnie James Dio track “Egypt” for a demo tribute recording. Due to the overwhelming response for more material, SLEDGE LEATHER was born and performed at Germany’s Keep It True festival in April 2011.

 

 

…TOP 100/ T0P 150 HEAVY METAL ALBUMS OF ALL-TIME IN THE TRADITIONAL METAL CATEGORY.  HEAVY METAL BANDS WITH WORLD-CLASS RIFF LORDS & FEATURING WORLD-CLASS VOCALIST… 

Abattoir * Vicious Attack

Accept * Restless and Wild

Acid * Acid

ACID * Manic

ACID * LIVE IN BELGIUM

Agent Steel- Skeptics Apocalypse

Agent Steel * Mad Locust Rising

Anacrusis- Screams and Whispers.

ANGEL DUST- INTO THE DARK PAST

Angel Witch * Angel Witch

ANNIHILATOR * ALICE IN HELL

Annihilator * Never, Neverland

ANTHRAX- FISTFUL OF METAL * MEGAFORCE RECORDS

Anthrax * ARMED AND DANGEROUS * MEGAFORCE RECORDS

Anthrax * Spreading the Disease … features songs written by Neil Turbin…

Anvil- Metal on Metal

ANVIL- FORGED IN FIRE

Anvil- Live in concert

Anvil-Worth the weight

ANVIL CHORUS * THOUGHT CRIMES

Anvil Chorus * The Killing Sun

Artillery * Fear Of Tomorrow

ARTILLERY * TERROR SQUAD

ARTILLERY * By Inheritance

ATHEIST- PIECE OF TIME

ATHEIST- UNQUESTIONABLE PRESENCE

Attacker-Battle at Helms Deep

Attacker-Second Coming

Attacker * Soul Taker

Attacker * The Unknown

Attacker * Giants of Cannan

Attacker * Sins of the World

AVATARIUM * AVATARIUM

AVATARIUM * GIRL WITH THE RAVEN MASK

AVATARIUM * HURRICANES AND HALOS

BATHROY * BATHORY

Bathory * The Return…

Benedectium “Uncreation”

BENEDICTUM “SEASON OF TRAGEDY”

Benediticum “Dominion”

Benedticum “Obey”

Bitch * Damnation Alley

Bitch- Be My Slave

Black Death * Black Death * Auburn Records

Black Sabbath- Mob Rules

BLIND ILLUSION- THE SANE ASYLUM

Bloodlust – Guilty As Sin

BLESSED DEATH * KILL OR BE KILLED * MEGAFORCE RECORDS

BLITZKRIEG * A TIME OF CHANGES

CACOPHONY- SPEED METAL SYMPHONY

Cage- Astrology

Cauchemar “Tenebrario”

Cauchemar “Chapelle ardente”

Candlemass-Nightfall

Carnivore * Carnivore

Cathedral- Supernatural Birth Machine

CELTIC FROST- MORBID TALES

Celtic Frost- Emperors Return

Celtic Frost- To Mega therion

CELTIC FROST- INTO THE PANDEMONIUM

CHASTAIN * MYSTERY OF ILLUSION

Chastain * Ruler of the Wasteland

Chastain * The 7th of Never

Chastain * The Voice of Cult

Chastain- For those who Dare

CHASTAIN- IN A OUTRAGE

CHASTAIN * WE BLEED METAL

Chastain * We Bleed Metal17

Christian Mistress “Agony & Opium”

Christian Mistress “Possession”

Christian Mistress “To Your Death”

COVEN * WITCHCRAFT REAPS MINDS AND DESTROYS SOULS…direct influence on MERCYFUL FATE

COVEN * JINX

COVEN * Worship New Gods…Coven …aka Coven13

CIRITH UNGOL * FROST AND FIRE

CIRITH UNGOL * KING OF THE DEAD

Crimson Glory- Crimson Glory

Crystal Viper “Legends”

CRYPTIC SLAUGHTER * CONVICTED

Crucified Barbara “In Distortion We Trust”

Crucified Barbara “”Til Death Do Us Party”

Crucified Barbara “The Midnight Chase”

Culprit- Guilty As Charged

CYNIC * FOCUS

Dark Age- Dark Age 1984 Gnarly Records/ Greenworld

Dark Angel * We Have Arrived

DARK ANGEL * DARKNESS DESCENDS

DARK ANGEL * LEAVE SCARS

DEF DEALER * KEEPER OF THE FLAME

DEF DEALER * JOURNEY INTO FEAR

DEATH- SCREAM BLOODY GORE

DEATH * LEPORSY

DEATH- SPIRITUAL HEALING

DEATH- HUMAN

DEATH-INDIVIDUAL THOUGH PATTERNS

DEATH * Symbolic

Death Angel- The Ultra-Violence

DEATH ANGEL- ACT III

DEATH PENALTY “DEATH PENALTY82”

Death Strike-Fuckin’ Death

Ded Engine * Ded Engine … aka ” Hot Shot ” in Europe

Ded Engine * Hot Shot

Ded Engine * Hold A Grudge

Deep Switch- Nine inches of God

Demona * Metal Through Time

Demona * Speak With The Devil

DESTRUCTION- INFERNAL OVERKILL

Détente “Recognize No Authority”

Détente “Decline”

Diamond Head * Diamond Head…1980 …aka Lightning to the Nations

Diamond Head- Lightning to the Nations

Diamond Head- Behold the Beginning

Discharge * Hear Nothing, See Nothing, Say Nothing

Dream Death- Journey Into Mystery

DOCTOR BUTCHER- DOCTOR BUTCHER

Doro * Force Majure

Doro * Doro

Doro “Warrior Soul”

Doro “Fear No Evil”

DORO “25 YEARS….AND STILL GOING STRONG”

DORO “RAISE YOUR FIST”

DORO * STRONG AND PROUD”

EDGE OF PARADISE * MASK

EDGE OF PARADISE * IMMORTAL WALTZ

EDGE OF PARADISE * ALIVE

ELECRIC WIZARD “BLACK MASS”

EXCITER- HEAVY METAL MANIAC

Exciter- VIOLENCE AND FORCE * ON MEGAFORCE RECORDS

EXCITCER HEAVY METAL MANIAC/ VIOLENCE AND FORCE …1989 CD …ON MEGAFORCE RECORDS

Exhorder- Slaughter in the Vatican

EXODUS- A LESSON IN VIOLENCE- 1984 ADVANCE CASSETTE

EXODUS- BONDED BY BLOOD

EXODUS- PLEASURES OF THE FLESH

EXODUS- A LESSON IN VIOLENCE (LIVE @ STUDIO 54 + 1986 demo with Paul Baloff)

EXODUS-ANOTHER LESSON IN VIOLENCE (LIVE)

EXODUS- BONDED BY BALOFF (A.L.I.V::REMASTERED)

Exorcist * Nightmare Theatre

EXUMER * POSSESSED BY FIRE

EXUMER * RISING FROM THE SEA

FATES WARNING * NIGHT ON BROKEN

Fear of God * Within The Veil

FIRESTRIKE “LION AND TIGER”

FORBIDDEN- FORBIDDEN EVIL

FORBIDDEN * TWISTED INTO FORM

THE GATHERING * MANDYLION

THE GATHERING * NIGHTTIME BIRDS

GIRLSCHOOL “HIT AND RUN….REVISITED”

GIRLSCHOOL “GUILTY AS SIN”

GRAVE DIGGER * HEAVY METAL BREAKDOWN * ON MEGAFORCE RECORDS

GRAVE DIGGER * WITCH KILLER * MEGAFORCE RECORDS

THE GREAT KAT- WORSHIP ME OR DIE!

THE GREAT KAT- BEETHOVEN ON SPEED

THE GREAT KAT- BEETHOVEN SHREDS

Griffin- Flight of the Griffin

Hawaii- One Nation Underground

HALLOWEEN * DON’T METAL WITH EVIL * 1984 ADVANCE ALBUM ON CASSETTE WITH ORIGINAL ARTWORK

HALLOWEEN- DON’T METAL WITH EVIL

HALLOWEEN – No One Gets Out! 

Halloween – No One Gets Out! Molten Metal Records Version w/ The Vicious Demo

Hell- Hell (1982)…1982-1986 Compilation that come with 2 disc version of 2011 CD

H-Bomb- Attaque

HEATHEN- BREAKING THE SILENCE

HEATHEN- VICTIMS OF DECEPTION

HEATHEN-RECOVERED

Hellion * The Black Book

Hellion * To Hellion and Back

HIRAX- RAGING VIOLENCE

HIRAX * NOT DEAD YET … RAGING VIOLENCE ON CD

HOLOCAUST- THE NIGHTCOMERS

Holy Moses * The New Machine of Lichtenstien

Holy Moses * Strength, Will, Power, Passion

Holy Moses * In the Power of Now

Imagika * Imagika

Imagika * Worship

IMAGIKA * And So it Burns

Infernal Majesty * None Shall Defy

Insanity- Death after Death

IRON MAIDEN- IRON MAIDEN

IRON MAIDEN- KILLERS

Iron Maiden- The Number of the Beast

Jaguar- Power Games

JAG PANZER- AMPLE DESTRUCTION

Judas Priest * Killing Machine

Judas Priest * Hellbent for Leather * aka Killing Machine

JUDAS PREIST * UNLEASHED IN THE EAST

Judas Priest- British Steel

Judas Priest- Painkiller

Kobra and the Lotus “Kobra and the Lotus”

Kobra and the Lotus “High Priestess”

King Diamond-Fatal Portrait

King Diamond- Abigail

King Diamond- Them

Kreator- Endless Pain

Kreator – Pleasure to Kill

Lady Beast * Lady Beast

Lady Beast * Lady Beast II

Lady Beast *  Metal Immortal

Liege Lord- Master Control

LUCIFER “LUCIFER I

Macbre- Gloom

Malediction- Condamnes

Manowar * Battle Hymns

MANOWAR- INTO GLORY RIDE * MEGAFORCE RECORDS

MANOWAR * HAIL TO ENGLAND

MASSACRE “FROM BEYOND”

MASSACRE “BACK FROM BEYOND”

MASTER- MASTER

MASTER- 1985 ALBUM UNRELEASED

Mastercastle “Last Desire”

MEDIEVAL- MEDIEVAL …aka 1983 Medieval Cassette album

Medieval- ALL KNOBS TO THE RIGHT

MEDIEVAL * MEDIEVAL …aka Reign of Terror 1986 EP

MEDIEVAL- MEDIEVAL KILLS

MEDIEVAL * CASSETTE ALBUM/ ALL KNOBS TO THE RIGHT — DOUBLE PLAY CLASSIC

THE MENTORS * YOU AXED FOR IT

MERCYFUL FATE- 1982 EP

MERCYFUL FATE- MELISSA

MERCYFUL FATE- DON’T BREAK THE OATH

MERCYFUL FATE- CURSE OF THE PHARAOHS

MERCYFUL FATE- THE BEGINNING

MERCYFUL FATE- RETURN OF THE VAMPIRE

MERCYFUL FATE- INTO THE SHADOWS

METAL CHURCH * METAL CHURCH * 1984 Ground Zero with extra track BIG GUNS

METAL CHRCH * METAL CHURCH * 1986 CD of the 1984 LP

METALLICA- KILL EM ALL * MEGAFORCE RECORDS

METALLICA – RIDE THE LIGHTNING * MEGAFORCE RECORDS

Morbid Angel- ABOMINATIONS OF DESOLATION

MORBID ANGEL- ALTARS OF MADNESS

MORBID ANGEL BLESSED ARE THE SICK

MORBID ANGEL * COVENANT

MORDBID ANGEL * DOMINATION

MORBID ANGEL* ENTANGLED IN CHAOS

Motorhead- Ace of Spades

MOTORHEAD- NO SLEEP TIL HAMMERSMITH

Motorhead * Iron Fist

Motorhead * Another Perfect Day

Motorhead * No Remorse

Motorhead * Orgasmatron

Mystery Blue “Hell and Fury”

Nasty Savage- Nasty Savage

NASTY SAVAGE- INDULGENCE

Nervosa “2012”

Nervosa  * TIME OF DEATH

Nervosa  *VICTIM OF YOURSELF

Nervosa “Agony”

THE OATH “THE OATH”

OBITUARY * SLOWLY WE ROT

OBITUARY * Cause of Death

Obilevon * From this Day Forward

Obliveon * Nemesis

ONSLAUGHT- THE FORCE

Original Sin * Sin Will Find You Out

OVERKILL- FEEL THE FIRE * MEGAFORCE RECORDS

OZ- Fire in the Brain

OZ – III Warning

Ozzy Osbourne- Blizzard of Ozz

Ozzy Osbourne-Diary of a Madman

Ozzy Osbourne * Tribute

Pagan Altar * 1982 Demo Cassette

Pagan Altar- Pagan Altar Volume 1

PAGAN ALTAR * Judgment of the Dead …* aka Voulume 1

PILE DRIVER- METAL INQUISITION

PILE DRIVER * STAY UGLY

Pentagram- Pentagram

Pentagram- Day of Reckoning

Pentagram * Relentless 1985 debut Retitled

Pentagram- Be forewarned

POSSESSED- SEVEN CHURCHES

RAVEN- ALL FOR ONE * MEFGAFORCE RECORDS

RAVEN * LIVE AT THE INFERNO * MEGAFORCE RECORDS

RAZOR- EXECUTIONERS SONG

RAZOR- EVIL INVADERS

REPULSION * SLAUGHTER OF THE INNOCENT

REPULSION – HORRIFIED

Resistance * ” Resistance”

Riot- Fire Down Under

Riot- Thunder Steel

Riot- Privilege of Power

RUSH * A FARWELL TO KINGS

RUSH * PEMANENT WAVES

RUSH- MOVING PICTURES

RUSH * EXIT…STAGE LEFT

RUSH- SIGNALS

RUSH- GRACE UNDER PRESSURE

RUSH- POWER WINDOWS

RUSH * HOLD YOUR FIRE

RUSH * A SHOW OF HANDS

RUSH * PRESTO

RUSH * CHRONICLES

RUSH * TEST FOR ECHO

RUSH * DIFFERENT STAGES–LIVE

SABBAT- HISTORY OF A TIME TO COME

SADUS * A VISION OF MISERY

Satan “Into the Fire”

SATAN “COURT IN THE ACT”

Satan “Suspended Sentence”

SATAN * LIVE IN THE ACT

Satan * Live Sentence”

Satan “Trail By Fire….”

Satan “Atom by Atom”

SAVAGE MASTER “Mask of Evil”

SAVATAGE * Sirens

SAVATAGE * The Dungeons are Calling

SACRIFICE- Torment in Fire

SACRIFICE * FORWARD TO TERMINATION

SACRIFICE * SOLIDERS OF MISFORTUNE

SACRIFICE * APOCALYPSE INSIDE

SCORPIONS * TAKEN BY FORCE

Sentinel Beast “DEPTHS OF DEATH”

SENTINEL BEAST “UP FROM THE ASHES”

SEPULTURA- BENEATH THE REMAINS

Skullview- Kings of the Universe

Sindrome- Sindrome (2 demos on CD)

SINDROME “RESURECTION….”

Sign of the Jackal *  Mark of the Beast

SLAUGHTER- STRAPPADO

SLAUTER XSTROYES * WINTERKILL

SLAUTER XSTROYES * FREE THE BEAST

SLAYER- SHOW NO MERCY

SLAYER- HAUNTING THE CHAPEL

SLAYER- LIVE UNDEAD

SLAYER- HELL AWAITS

Slayer- Reign in Blood

SODOM * IN THE SIGN OF EVIL

SODOM * OBSESSED BY CRUELTY

STORMTROOPERS OF DEATH * SPEAK ENGLISH OR DIE * MEGAFORCE RECORDS

SUICDIAL TENDENCIES * SUICIDAL TENDENCES

SYRIS * Unseen Forces

Tank- Filth Hounds of Hades

Tank- Power of the Hunter

TANK- THIS MEANS WAR

TERRORIZER-WORLD DOWNFALL

Testament- The Legacy

TROUBLE- PSALMS 9

TROUBLE * THE SKULL

TROUBLE * RUN TO THE LIGHT

TYGERS OF PAN TANG- WILD CAT

Tygers of Pan Tang- Spell Bound

Tyranex * Extermination Has Begun

Tyranex * Unable to Tame

TWISTED SISTER–UNDER THE BLADE.

UFO- The Wild, The Willing, The Innocent

Unseen Terror- Human Error

Vainglory * Vainglory

Venom- Welcome to Hell

Venom- Black Metal

Venom * At War with Satan

VICIOUS RUMORS * Soldiers of the Night

VICIOUS RUMORS * Digital Dictator

VIO-LENCE * ETERNAL NIGHTMARE

Voi Vod- War and Pain

Voi Vod- RRRROOOOAAAARRR

Wargasm- Why Play Around ?

Warfare * Pure Filth

WARFARE-METAL ANARCHY

Warfare * Mayhem Fucking Mayhem

Warlock * Burning The Witches

Warlock * Hellbound

Warlock * True As Steel

WARLOCK * TRIMPH AND AGONY”

Warlord-Deliver Us

Warlord * And The Cannons Of Destruction Have Begun

Warlord * Thy Kingdom Come * 1st EP and LP on CD

Warhead * Speedy Way

WARHEAD- THE DAY AFTER

Warning- Aftermath

WATCHTOWER- ENERGETIC DISASSEMBLY

Watchtower * Control and Resistance

WITCHCROSS- FIT FOR FIGHT

WITCHFINDER GENERAL- DEATH PENALTY

WITCHFINDER GENERAL- FRIENDS OF HELL

WildeStarr “Arrival”

WildeStarr “A Tell Tale Heart”

WildeStarr “Beyond The Rain”

Witchkiller- Day of the Saxon

Zoser Mez- Vizer of Wasteland